header logo image


Page 47«..1020..46474849..6070..»

Archive for the ‘Arthritis’ Category

Can-Fite and Gebro Pharma holding European Conference on Development & Commercialization of Phase III Drug Candidate Piclidenoson in the Treatment…

Thursday, October 17th, 2019

PETACH TIKVA, Israel--(BUSINESS WIRE)--

Can-Fite BioPharma Ltd. (NYSE MKT: CANF) (TASE:CFBI), a biotechnology company with a pipeline of proprietary small molecule drugs that address cancer, liver and inflammatory diseases and Gebro Pharma, a European mid-size Pharmaceutical company announced today it is holding an International Advisory Board conference with a panel of eleven Key Opinion Leaders in rheumatoid arthritis from Austria, Switzerland, and Spain focused on Piclidenoson.

Gebro Pharma has licensed the distribution rights to Piclidenoson for the indications of rheumatoid arthritis and psoriasis in Austria, Switzerland, and Spain. The purpose of the meeting, which is taking place in Fieberbrunn, Austria, Gebro Headquarters, on October 17-18, 2019, is to conduct a scientific review of Piclidenoson, the role of the Adenosidne receptor A3 and mechanism of action of the molecule and aspects related to patient populations. Can-Fites CEO Dr. Pnina Fishman, Medical Director Dr. Michael Silverman, and VP Business Development Dr. Sari Fishman are delivering presentations at the conference together with the participation of European Key Opinion Leaders in rheumatoid arthritis, Dr. Burkhard Leeb and Dr. Sander W. Tas.

Can-Fite is currently enrolling 500 patients in Europe, Canada, and Israel in a Phase III study of Piclidenoson as a first-line treatment for rheumatoid arthritis. The study will evaluate Piclidenoson as compared to placebo, and compared to methotrexate, the current standard of care for first-line treatment of rheumatoid arthritis.

This highly productive forum with our distribution partner Gebro is an opportunity for us to engage directly with their network of doctors in Europe regarding how Piclidenoson may meet an unmet need for patients who seek a safe and effective treatment for newly diagnosed rheumatoid arthritis, stated Can-Fite CEO Dr. Pnina Fishman.

Gebro considers Piclidenoson as an important milestone to strengthen its competence in the treatment of RA and psoriasis and to provide patients with an innovative concept of treatment for such diseases, stated Gebro Pharma CEO Dr. Christian Kollenz.

About Piclidenoson

Piclidenoson is a novel, first-in-class, A3 adenosine receptor agonist (A3AR) small molecule, orally bioavailable drug with a favorable therapeutic index demonstrated in Phase II clinical studies. Piclidenoson is currently under development for the treatment of autoimmune inflammatory diseases. It is being evaluated in a Phase III study as a first line treatment for rheumatoid arthritis and a Phase III study in the treatment of moderate-to-severe psoriasis.

About Can-Fite BioPharma Ltd.

Can-Fite BioPharma Ltd. (NYSE American: CANF) (TASE:CFBI) is an advanced clinical stage drug development Company with a platform technology that is designed to address multi-billion dollar markets in the treatment of cancer, inflammatory disease and sexual dysfunction. The Company's lead drug candidate, Piclidenoson, is currently in Phase III trials for rheumatoid arthritis and psoriasis. Can-Fite's liver cancer drug, Namodenoson, recently completed a Phase II trial for hepatocellular carcinoma (HCC), the most common form of liver cancer, and is in a Phase II trial for the treatment of non-alcoholic steatohepatitis (NASH). Namodenoson has been granted Orphan Drug Designation in the U.S. and Europe and Fast Track Designation as a second line treatment for HCC by the U.S. Food and Drug Administration. Namodenoson has also shown proof of concept to potentially treat other cancers including colon, prostate, and melanoma. CF602, the Company's third drug candidate, has shown efficacy in the treatment of erectile dysfunction in preclinical studies and the Company is investigating additional compounds, targeting A3AR, for the treatment of sexual dysfunction. These drugs have an excellent safety profile with experience in over 1,000 patients in clinical studies to date. For more information please visit: http://www.can-fite.com.

About Gebro Pharma

Gebro Pharma is a privately-owned leading pharma group founded in Austria in the late 1940s, with over 500 employees and more than 70 years of experience in research, manufacturing and marketing of pharmaceutical specialties. Its headquarters are located in Fieberbrunn (Austria), where Gebro is one of the main local players, with commercial operations also in Spain and Switzerland. With a total turnover of 185M in 2018, Gebro is positioned as a leader in pain and rheumatology with a strong portfolio.

Story continues

Additionally, Gebro Pharma has also built a portfolio around urology, respiratory, dermatology, GI and CV depending on the territory.

Forward-Looking Statements

This press release may contain forward-looking statements, about Can-Fites expectations, beliefs or intentions regarding, among other things, market risks and uncertainties, its product development efforts, business, financial condition, results of operations, strategies or prospects. In addition, from time to time, Can-Fite or its representatives have made or may make forward-looking statements, orally or in writing. Forward-looking statements can be identified by the use of forward-looking words such as believe, expect, intend, plan, may, should or anticipate or their negatives or other variations of these words or other comparable words or by the fact that these statements do not relate strictly to historical or current matters. These forward-looking statements may be included in, but are not limited to, various filings made by Can-Fite with the U.S. Securities and Exchange Commission, press releases or oral statements made by or with the approval of one of Can-Fites authorized executive officers. Forward-looking statements relate to anticipated or expected events, activities, trends or results as of the date they are made. Because forward-looking statements relate to matters that have not yet occurred, these statements are inherently subject to risks and uncertainties that could cause Can-Fites actual results to differ materially from any future results expressed or implied by the forward-looking statements. Many factors could cause Can-Fites actual activities or results to differ materially from the activities and results anticipated in such forward-looking statements. Factors that could cause our actual results to differ materially from those expressed or implied in such forward-looking statements include, but are not limited to: our history of losses and needs for additional capital to fund our operations and our inability to obtain additional capital on acceptable terms, or at all; uncertainties of cash flows and inability to meet working capital needs; the initiation, timing, progress and results of our preclinical studies, clinical trials and other product candidate development efforts; our ability to advance our product candidates into clinical trials or to successfully complete our preclinical studies or clinical trials; our receipt of regulatory approvals for our product candidates, and the timing of other regulatory filings and approvals; the clinical development, commercialization and market acceptance of our product candidates; our ability to establish and maintain strategic partnerships and other corporate collaborations; the implementation of our business model and strategic plans for our business and product candidates; the scope of protection we are able to establish and maintain for intellectual property rights covering our product candidates and our ability to operate our business without infringing the intellectual property rights of others; competitive companies, technologies and our industry; statements as to the impact of the political and security situation in Israel on our business; and risks and other risk factors detailed in Can-Fites filings with the SEC and in its periodic filings with the TASE. In addition, Can-Fite operates in an industry sector where securities values are highly volatile and may be influenced by economic and other factors beyond its control. Can-Fite does not undertake any obligation to publicly update these forward-looking statements, whether as a result of new information, future events or otherwise.

For more information please visit:

http://www.gebro.es

DISCLAIMER

In compliance with article 101.c) 16 of Law 29/2006, this press release can only be circulated to specialized media addressed to authorized personnel for the prescription or dispensation of drugs.

LABORATORIOS GEBRO PHARMA S.A. will hold responsible anyone who acts contrary to our indications in terms of dissemination of information for all the consequences and/or claims from third parties that may arise from the breach.

View source version on businesswire.com: https://www.businesswire.com/news/home/20191017005438/en/

Visit link:
Can-Fite and Gebro Pharma holding European Conference on Development & Commercialization of Phase III Drug Candidate Piclidenoson in the Treatment...

Read More...

Osteoarthritis and arthritis: it’s not only older people who are at risk – Her.ie

Thursday, October 17th, 2019

October 12 is World Arthritis Day.

An incredibly common condition, it currently affects one in five people living in Ireland today. Despite this, our understanding of arthritis - and osteoarthritis - can sometimes be lacking.

Senior lecturer in physiotherapy at RCSI and musculoskeletal clinical specialistDr Helen French says that the most common myth about osteoarthritis is that it only affects older people.

And the second most common myth is that all older people are bound to get it.

We think about osteoarthritis as only affecting older people, but wed like to get the message across that thats not just the case," she says.

"People have a fear of osteoarthritis, or they think its normal if youre old and that its just part of regular ageing - but its not.

"Joint replacement is for the minority, not everybody will have to have a joint replaced."

In Ireland, one in five people will be diagnosed with some form of arthritis in their lifetime.

Women are two to three times more likely to be diagnosed withosteoarthritis too, with 18 percent ofarthritis patients in Ireland being less than 55 years old.

The most common form of arthritis, osteoarthritis, causes damage to joints by wearing down the protective cartilage that cushions the ends of the bones.

It tends to relate to joints in the knees, hips, and spine more severely, but any joint in the body can be affected by the condition.

Theres a few different risk factors," says Dr French. "Sometimes its genetics, other times its obesity because weight is a critical factor."

"It could also be caused by a hormonal influence though there isnt substantive evidence to prove that."

Dr French says that despite misconceptions about the condition, more and more people under the age of 45 are being diagnosed with osteoarthritis.

A lot of them are young women and - in particular - young sporting women.

"Not a lot of women think about this," she says. "Sportswomen would be high risk because if youre a high level athlete and youre doing a twisting-turning sport like soccer or rugby, then you can easily injure the ligaments in your knee or your ankle.

"Men can often get similar injuries playing the likes of GAA, but it is more common in women because of our biomechanics and because of the way we move.

"Research has shown that young sportswomen are more at risk of developing osteoarthritis 10 years after they start playing (...)but the key message were trying to get across is that preventative measures are possible."

Osteoarthritis affects a person's day-to-day life. Everything from getting up in the morning to getting out of a chair to driving a car can be affected by the condition.

The stiffness caused by joint movement can also have a knock on effect on how a person partakes in hobbies or sport - and even on how they do their job.

"It does affect every day activities that we take for granted," says Dr French. "You can have a really high quality of life with osteoarthritis, but to ensure this we need to have a better understanding of the condition, as well as how to manage it."

There are three core recommendations for dealing with osteoarthritis as a young person.

The first is weight management as obesity has been proven to increase a person's risk of developing the condition.

The second is exercise and the third is self-management, with medication to ease the symptoms of the condition being on the second line of control.

Dr French says that another one of the most common myths abut osteoarthritis is that you shouldn't exercise when you have it when, in fact, you should.

"You should exercise more than normal," she says. "You may need to go to a physiotherapist and get an individual approach to suit your needs and make sure youre doing the right type of exercise, like a specific strengthening exercise.

"The needs should suit the person, but you should definitely be doing it.

You can find out more about osteoarthritis via Arthritis Ireland here.

If you are concerned about your health, you should always contact your GP.

Read more:
Osteoarthritis and arthritis: it's not only older people who are at risk - Her.ie

Read More...

World Arthritis Day 2019: History and Theme – Jagran Josh

Thursday, October 17th, 2019

Arthritis is very prevalence among the old age persons. This is more prevalent than diabetes like AIDS and cancer etc. Lets read about the Arthritis on the occasion of World Arthritis Day.

What is Arthritis?

Arthritis literally means the swelling and tenderness of one or more joints which leads to pain and stiffness in the joints. There are various types of arthritis. Rheumatoid arthritis is an autoimmune condition that can affect people at any age while osteoarthritis is the most common reason for age-related joint pain.

The main symptoms of arthritis are pain and stiffness in joints which usually worsen with age. But don't think that arthritis is inevitable in the old age persons.

History of World Arthritis Day:

October 12 is celebrated as World Arthritis Day since 1996. It was started by the Arthritis and Rheumatism International (ARI) to increase global awareness about the rheumatic and musculoskeletal diseases (RMD).

What is Ebola Virus?

World Arthritis Day 2019 Theme:

Each World Arthritis Day has a theme since 2017. The theme of year 2017 was Dont Delay, Connect Today which continue till 2018. The theme for World Arthritis Day 2019 is "Time2Work". This theme would be followed in the financial year 2020 also.

Worth to mention that before 2017, World Arthritis Day; didnt have any theme.

The European League Against Rheumatism, (EULAR's) campaign

The "Dont Delay, Connect Today" campaign targets to highlight that early diagnosis of rheumatic and musculoskeletal diseases (RMD) and access to treatment can prevent further damage.

Patients of the World Arthritis Day

Arthritis affects around 15% people i.e. over 180 million people in India. World Health Organization (WHO) data show that 0.3-1% of the worlds population has rheumatoid arthritis and, 18% women while around 10% men above the 60 years have symptomatic osteoarthritis.

There are around 120 million people are currently living with a rheumatic disease (RMD) in the European Union alone.

The World Arthritis Day is dedicated to raise awareness about Arthritis; affecting people with rheumatic and musculoskeletal diseases. An organisation European League Against Rheumatism (EULAR) tries its best efforts to promote the awareness about the World Arthritis Day and its importance. EULAR also sets the theme for this day.

Treatment of the Arthritis

Osteoarthritis is a age related problem which can also be mitigate by drinking more than 2 litres of water a day, avoidance of fatty & oily food and sweetened beverages while inclusion of good vegetarian protein diet and Physiotherapy treatment.

So this was the complete detailed information on the World Arthritis Day 2019. The theme of World Arthritis Day 2019 "Time2Work"is very important for various exams hence be attentive about it.

World Hepatitis Day 2019: Current Theme, History and Significance

Here is the original post:
World Arthritis Day 2019: History and Theme - Jagran Josh

Read More...

Arthritis: Symptoms, treatment and causes

Sunday, September 29th, 2019

What is arthritis?

Arthritis simply means a painful condition of the joints.

There are different types of the disease many inflammatory, for example rheumatoid arthritis (RA), and others more degenerative in nature, for example osteoarthritis (OA).

Arthritis may be preceded or accompanied by a period of fatigue and a feeling of stiffness. This appears more in rheumatoid arthritis than in osteoarthritis.

Pain in the joints in rheumatoid arthritis almost always begins in the hands, especially in the knuckles, and often in both hands simultaneously, as one of the commonest types of inflammatory arthritis.

Arthritis can affect all joints in the body, and it's impossible to predict which or how many joints will be attacked.

We do not know the cause of arthritis. In rheumatoid arthritis, the theory that it's triggered by an infection has never been proved. It may be partly hereditary, and it occurs three times as often in women as in men.

All age groups can develop arthritis even children but usually rheumatoid arthritis appears between the ages of 30 and 35.

The disease is unpredictable and the treatment difficult. But there are several medical remedies that can both ease the pain and slow down the spread of the disease and the damage it causes.

Some doctors may recommend a diet, but there's no evidence that dietary changes alone can ease or stop the development of arthritis.

Simple painkillers can help. When used with caution, non-steroidal anti-inflammatory drugs (NSAIDs) can provide relief from pain, as well as stiffness. These are prescribed more often in rheumatoid arthritis than in osteoarthritis.

Overweight patients should aim to reduce weight with appropriate diet and exercise.

It's important for patients with arthritis to obtain help to keep the muscles and joints active and to be supported in leading a normal life.

Physiotherapists, who are trained to maintain a patient's physical ability and relieve pain, and occupational therapists, who assess physical ability and provide help and advice including aids, play a large part in making life bearable for arthritis sufferers.

During recent years, there has been great progress in the treatment of arthritis particularly with the use of artificial joints. Some people still have to live with the discomfort of the disease because not all joints can be replaced surgically.

Research has suggested that the natural treatment glucosamine sulphate, taken at a daily dose of 1500mg, is effective in relieving arthritis symptoms particularly of the knee joints in patients with osteoarthritis rather than rheumatoid arthritis.

Rheumatoid arthritis patients benefit from disease modifying drugs, such as sulphasalazine and methotrexate, or even the latest biologic treatments in those who fail with routine drugs (anti-TNF drugs and others (rituximab).

Based on a text by Dr Erik Fangel Poulsen, specialist, Dr Per Grinsted, GP

Last updated 27.07.2010

See the article here:
Arthritis: Symptoms, treatment and causes

Read More...

Osteoporosis and Arthritis: Two Common but Different …

Sunday, September 29th, 2019

Many people confuse osteoporosis and some types of arthritis. This fact sheet discusses the similarities and differences between these conditions.

Osteoporosis is a condition in which the bones become less dense and more likely to fracture. In the United States, more than 53 million people either already have osteoporosis or are at high risk due to low bone mass. In osteoporosis, there is a loss of bone tissue that leaves bones less dense and more likely to fracture. It can result in a loss of height, severe back pain, and change in ones posture. Osteoporosis can impair a persons ability to walk and can cause prolonged or permanent disability.

Risk factors for developing osteoporosis include:

Osteoporosis is known as a silent disease because it can progress undetected for many years without symptoms until a fracture occurs. Osteoporosis is diagnosed by a bone mineral density test, which is a safe and painless way to detect low bone density.

Although there is no cure for the disease, the U.S. Food and Drug Administration has approved several medications to prevent and treat osteoporosis. In addition, a diet rich in calcium and vitamin D, regular weight-bearing exercise, and a healthy lifestyle can prevent or lessen the effects of the disease.

Arthritis is a general term for conditions that affect the joints and surrounding tissues. Joints are places in the body where bones come together, such as the knees, wrists, fingers, toes, and hips. Two common types of arthritis are osteoarthritis and rheumatoid arthritis.

Although osteoporosis and osteoarthritis are two very different medical conditions with little in common, the similarity of their names causes great confusion. These conditions develop differently, have different symptoms, are diagnosed differently, and are treated differently.

Osteoporosis and arthritis do share many coping strategies. With either or both of these conditions, many people benefit from exercise programs that may include physical therapy and rehabilitation. In general, exercises that emphasize stretching, strengthening, posture, and range of motion are appropriate. Examples include low-impact aerobics, swimming, tai chi, and low-stress yoga. However, people with osteoporosis must take care to avoid activities that include bending forward from the waist, twisting the spine, or lifting heavy weights. People with arthritis must compensate for limited movement in affected joints. Always check with your doctor to determine whether a certain exercise or exercise program is safe for your specific medical situation.

Most people with arthritis will use pain management strategies at some time. This is not always true for people with osteoporosis. Usually, people with osteoporosis need pain relief when they are recovering from a fracture. In cases of severe osteoporosis with multiple spine fractures, pain control also may become part of daily life. Regardless of the cause, pain management strategies are similar for people with osteoporosis, OA, and RA.

For updates and for any questions about any medications you are taking, please contact

U.S. Food and Drug AdministrationToll Free: 888-INFO-FDA (888-463-6332)Website: https://www.fda.gov

For additional information on specific medications, visit Drugs@FDA at https://www.accessdata.fda.gov/scripts/cder/daf. Drugs@FDA is a searchable catalog of FDA-approved drug products.

NIH Pub. No. 18-7893

Read the original here:
Osteoporosis and Arthritis: Two Common but Different ...

Read More...

Rheumatoid arthritis – Symptoms and causes – Mayo Clinic

Thursday, June 6th, 2019

Overview

Rheumatoid arthritis is a chronic inflammatory disorder that can affect more than just your joints. In some people, the condition can damage a wide variety of body systems, including the skin, eyes, lungs, heart and blood vessels.

An autoimmune disorder, rheumatoid arthritis occurs when your immune system mistakenly attacks your own body's tissues.

Unlike the wear-and-tear damage of osteoarthritis, rheumatoid arthritis affects the lining of your joints, causing a painful swelling that can eventually result in bone erosion and joint deformity.

The inflammation associated with rheumatoid arthritis is what can damage other parts of the body as well. While new types of medications have improved treatment options dramatically, severe rheumatoid arthritis can still cause physical disabilities.

Signs and symptoms of rheumatoid arthritis may include:

Early rheumatoid arthritis tends to affect your smaller joints first particularly the joints that attach your fingers to your hands and your toes to your feet.

As the disease progresses, symptoms often spread to the wrists, knees, ankles, elbows, hips and shoulders. In most cases, symptoms occur in the same joints on both sides of your body.

About 40 percent of the people who have rheumatoid arthritis also experience signs and symptoms that don't involve the joints. Rheumatoid arthritis can affect many nonjoint structures, including:

Rheumatoid arthritis signs and symptoms may vary in severity and may even come and go. Periods of increased disease activity, called flares, alternate with periods of relative remission when the swelling and pain fade or disappear. Over time, rheumatoid arthritis can cause joints to deform and shift out of place.

Make an appointment with your doctor if you have persistent discomfort and swelling in your joints.

Rheumatoid arthritis occurs when your immune system attacks the synovium the lining of the membranes that surround your joints.

The resulting inflammation thickens the synovium, which can eventually destroy the cartilage and bone within the joint.

The tendons and ligaments that hold the joint together weaken and stretch. Gradually, the joint loses its shape and alignment.

Doctors don't know what starts this process, although a genetic component appears likely. While your genes don't actually cause rheumatoid arthritis, they can make you more susceptible to environmental factors such as infection with certain viruses and bacteria that may trigger the disease.

Factors that may increase your risk of rheumatoid arthritis include:

Rheumatoid arthritis increases your risk of developing:

Follow this link:
Rheumatoid arthritis - Symptoms and causes - Mayo Clinic

Read More...

10 Low-Carb Holiday Appetizers – Kidney Diet Tips

Tuesday, March 26th, 2019

Holidays are filled with family get-togethers and also the temptation to consume unhealthy foods. Holiday appetizers can be amain source of carbohydrates (carbs), adding extra sugar and possibly unwanted calories. Your holiday doesnt have to be calorie-laden and carb-filled.

Start your holiday off right with this collection of low-carb appetizers. Using low-potassium vegetables as dippers instead of crackers or chips can help keep carbs in balance.

Enjoy some of the holiday classics with a low-carb twist for a happy and healthy holiday season. In addition, these recipes are low in potassium, sodium and phosphorus.

If you are traveling this holiday season, tap into the DaVita collection of recipes and cookbooks to add spice to your holiday meals wherever you go. This seasons Todays Kidney Diet Holiday Gatherings offers a collection of recipes that you can serve or take to your next holiday event. Check out these 10 Holiday Destinations for Dialysis-Friendly Travelto learn more about events and things to do in some great places. Ask your dietitian for additional guidelines for your kidney diet and for holiday eating away from home.

Happy Holidays!

This article is for informational purposes only and is not a substitute for medical advice or treatment. Consult your physician and dietitian regarding your specific diagnosis, treatment, diet and health questions.

Read more:
10 Low-Carb Holiday Appetizers - Kidney Diet Tips

Read More...

Arthritis | Crohns & Colitis Foundation

Sunday, March 3rd, 2019

Arthritis, or inflammation of the joints, is the most common extraintestinal complication of IBD. It may affect as many as 25% of people with Crohns disease or ulcerative colitis. Although arthritis is typically associated with advancing age, in IBD it often strikes the youngest patients. In addition to joint pain, arthritis also causes swelling of the joints and a reduction in flexibility.

In IBD, arthritis may appear in three different forms. These are:

Peripheral arthritis usually affects the large joints of the arms and legs, including the elbows, wrists, knees, and ankles. The discomfort may be migratory, moving from one joint to another. If left untreated, the pain may last from a few days to several weeks. Peripheral arthritis tends to be more common among people who have ulcerative colitis or Crohns disease of the colon. The level of inflammation in the joints generally mirrors the extent of inflammation in the colon. Although no specific test can make a definitive diagnosis, various diagnostic methodsincluding analysis of joint fluid, blood tests, and X-raysare used to rule out other causes of joint pain. Fortunately, IBD-related peripheral arthritis usually does not cause any lasting damage.

Also known as spondylitis or spondyloarthropathy, axial arthritis produces pain and stiffness in the lower spine and sacroiliac joints (at the bottom of the back). Interestingly, and especially in young people, these symptoms may come on months or even years before the symptoms of IBD appear. Unlike peripheral arthritis, axial arthritis may cause permanent damage if the bones of the vertebral column fuse togetherthereby creating decreased range of motion in the back. In some cases, a restriction in rib motion may make it difficult for people to take deep breaths. Active spondylitis generally subsides by age 40. Therapy for people with axial arthritis is geared toward improving range of motion in the back. Stretching exercises are recommended, as is the application of moist heat to the back.

A more severe form of spinal arthritis, ankylosing spondylitis (AS) is a rare complication, affecting between 2% and 3% of people with IBD. It is seen more often in Crohns disease than in ulcerative colitis. In addition to causing arthritis of the spine and sacroiliac joints, ankylosing spondylitis can cause inflammation of the eyes, lungs, and heart valves. The cause of AS is not known, but most affected individuals share a common genetic marker. In some cases, the disease occurs in genetically predisposed people after exposure to bowel or urinary tract infections. Occasionally, AS foretells the development of IBD. AS typically strikes people under the age of 30, mainly adolescents and young adult males, appearing first as a dramatic loss of flexibility in the lower spine. Rehabilitation therapy is essential to help maintain joint flexibility. But even with optimal therapy, some people will develop a stiff or ankylosed spine. Symptoms of AS may continue to worsen even after surgical removal of the colon.

It is not always easy to determine whether the arthritis is linked to the intestinal condition. In general, the arthritis that complicates IBD is not as severe as rheumatoid arthritis. The joints do not ordinarily undergo destructive changes, and joint involvement is not symmetric (affecting the same joints on both sides of the body). Except for ankylosing spondylitis, arthritis associated with IBD usually improves as intestinal symptoms improve.

In the general population, people with peripheral arthritis may use nonsteroidal anti-inflammatory drugs (NSAIDs) to reduce pain and swelling of the joints. However, as a rule, these medicationswhich include aspirin and ibuprofen are not an option for everyone with IBD because they can prompt a disease flare by irritating the intestinal lining and intensifying the inflammation. (It should be noted, though, that some people with IBD can tolerate NSAIDs and find these medications helpful in relieving symptoms of arthritis.) Corticosteroids also may be used to treat the arthritis symptoms as well as IBD.

In most cases, doctors manage the symptoms of peripheral arthritis by controlling the inflammation within the colon. Once that has subsided after a course of a medication such as prednisone or sulfasalazine, joint pain generally disappears. Similarly, the newer biologic agents such as infliximab (Remicade) have also been shown to be effective in reducing joint inflammation and swelling. Infliximab has even shown good results as a treatment for ankylosing spondylitis. Only axial arthritis seems not to improve as the intestinal inflammation resolves. Unlike peripheral arthritis, there is no correlation between treatment of the underlying IBD and improvement in axial arthritis symptoms.

In addition to medication, doctors may recommend resting the affected joint as well as the occasional use of moist heat. Range of motion exercises, as demonstrated by a physical therapist, may also be helpful.

The Crohns & Colitis Foundation of America provides information for educational purposes only. We encourage you to review this educational material with your health care professional. The Foundation does not provide medical or other health care opinions or services. The inclusion of another organizations resources or referral to another organization does not represent an endorsement of a particular individual, group, company or product.

For further information, call Crohn's & Colitis Foundation's IBD Help Center: 888.MY.GUT.PAIN (888.694.8872).

The Crohn's & Colitis Foundation provides information for educational purposes only. We encourage you to review this educational material with your health care professional. The Foundation does not provide medical or other health care opinions or services. The inclusion of another organization's resources or referral to another organization does not represent an endorsement of a particular individual, group, company or product.

Questions or Want to Talk?

Visit link:
Arthritis | Crohns & Colitis Foundation

Read More...

Arthritis Pain Relief Products | TYLENOL

Sunday, January 13th, 2019

Arthritis Pain Relief Products | TYLENOLSkip to main content

Asset Name:

1.2_Arthritis_Products_Marquee.jpg

Dont let Arthritis get in the way of your day. TYLENOL 8 HR ARTHRITIS Pain provides two layers of pain relief that work fast and last all day*

*Up to 8 hours

Works fast and lasts all day, up to 8 hours.Available as caplets.

Log in using your account with

By registering, you agree to receive additional communications regarding product information, promotions, newsletters and surveys from our site. If you choose to register with a social provider, certain information will be shared by your social provider with our site.

{* traditionalSignIn_signInButton *}

Welcome back, {* welcomeName *}!

Welcome back!

{* traditionalSignIn_signInButton *}

All Fields required, unless otherwise indicated

Will be used as your user name

By submitting your information above, you agree that the information you provide will be governed by our site's Privacy Policy.

By submitting your information you agree to our sites Privacy Policy.

All fields required unless otherwise indicated

Will be used as your user name

Your first name and last initial will be displayed publicly to other users when you write a review or blog post (ex. John S.).

Who in your household do you buy TYLENOL for? Select all that apply:{* answerWhoBuyMyself *}{* answerWhoBuyAnotherAdult *}{* answerWhoBuyChildren *}

If you have children, what ages are they? Select all that apply:{* answerChildrenNone *}{* answerChildrenUpToOne *}{* answerChildrenUpToFive *}{* answerChildrenUpToEleven *}{* answerChildrenUpToEighteen *}

Which of the following describes your household's use of products from TYLENOL ? Select all that apply:{* answerProductMinorAches *}{* answerProductMinorArthritis *}{* answerProductPostSurgical *}{* answerProductHeadache *}{* answerProductPremenstrual *}{* answerProductPain *}{* answerProductFever *}{* answerProductCold *}

By submitting your information above, you agree that the information you provide will be governed by our site's Privacy Policy.

All fields required

Looks like you have an existing account with us. We have made some changes to our site and we need you to create a new password in order to login. Click send to recieve an email with instructions on how to create your new password.

Please check your email for a reset link to continue the reset process.

{* mergeAccounts *}

By clicking "Accept" below, you confirm that you have read, understand and accept our sites's Privacy Policy

You do not meet the minimum age requirement to sign in to this site

The rest is here:
Arthritis Pain Relief Products | TYLENOL

Read More...

7 Foods Arthritis Sufferers Should Avoid – HealthPrep

Sunday, January 13th, 2019

Arthritis is a condition that stems from the degeneration and/or overuse of joints, mostly affecting the knees, fingers, and hips. Australia (15%) and the United States (over 20%) have some of the highest rates of arthritis in the Western world. Evidence of arthritis has even been discovered in dinosaurs as well as being found in human remains from as early as 4500 BC. Today, people with arthritis can manage joint pain and swelling in a variety of ways, including what they consume in their everyday diet. Although there is no prescriptive diet for arthritis sufferers, this article will explore 7 foods that people with arthritis should stay away from. As always, consult your physician before making major changes in your diet.

It has long been known that fried food is bad for just about anyone due to the amount of saturated fat. A lot of fried food is also from a freezer and is often overly processed, as well as being high in salt and artificial preservatives. These all have a negative effect on a person with arthritis. Consuming a lot of fried food also has a connection to obesity, which in turn can fast track the degenerative process of joints; this is due to the extra weight and load being placed on the knees and hips. Fried meats should specifically be avoided by arthritis sufferers.

Read the original:
7 Foods Arthritis Sufferers Should Avoid - HealthPrep

Read More...

5 Worst Foods for Arthritis and Joint Pain

Sunday, January 6th, 2019

This video player is not support on your device, please click HERE to try a different player. We apologize for this inconvenience.

How long would YOU like to be pain free?

Look, I know you're skeptical. You should be. Look at all the big drug companies who are lying to you each and every day trying to convince you that their dangerous (sometimes deadly!) drugs are safe.

So I thought there's no better way for you to find out if Heal-n-Soothe will work for you, than having you try it. And that's why I'd like to send you a 90 count bottle, a 30 day supply, for free. You just pay the shipping and handling.

No matter what your arthritis pain level and frequency, fill out the risk-free acceptance form below to see how well Heal-n-Soothe Arthritis will work for you.

STEP 1: Where Should We Ship Your FREE Bottle?

Country *

Choose your country AFGHANISTANALBANIAALGERIAAMERICAN SAMOAANDORRAANGOLAANGUILLAANTARCTICAANTIGUA AND BARBUDAARGENTINAARMENIAARUBAAUSTRALIAAUSTRIAAZERBAIJANBAHAMASBAHRAINBANGLADESHBARBADOSBELARUSBELGIUMBELIZEBENINBERMUDABHUTANBOLIVIABOSNIA AND HERZEGOVINABOTSWANABOUVET ISLANDBRAZILBRITISH INDIAN OCEAN TERRITORYBRUNEI DARUSSALAMBULGARIABURKINA FASOBURUNDICAMBODIACAMEROONCANADACAPE VERDECAYMAN ISLANDSCENTRAL AFRICAN REPUBLICCHADCHILECHINACHRISTMAS ISLANDCOCOS (KEELING) ISLANDSCOLOMBIACOMOROSCONGOCONGO, THE DEMOCRATIC REPUBLIC OF THECOOK ISLANDSCOSTA RICACOTE D'IVOIRECROATIACUBACYPRUSCZECH REPUBLICDENMARKDJIBOUTIDOMINICADOMINICAN REPUBLICECUADOREGYPTEL SALVADOREQUATORIAL GUINEAERITREAESTONIAETHIOPIAFALKLAND ISLANDS (MALVINAS)FAROE ISLANDSFIJIFINLANDFRANCEFRENCH GUIANAFRENCH POLYNESIAFRENCH SOUTHERN TERRITORIESGABONGAMBIAGEORGIAGERMANYGHANAGIBRALTARGREECEGREENLANDGRENADAGUADELOUPEGUAMGUATEMALAGUINEAGUINEA-BISSAUGUYANAHAITIHEARD ISLAND AND MCDONALD ISLANDSHOLY SEE (VATICAN CITY STATE)HONDURASHONG KONGHUNGARYICELANDINDIAINDONESIAIRAN, ISLAMIC REPUBLIC OFIRAQIRELANDISRAELITALYJAMAICAJAPANJORDANKAZAKHSTANKENYAKIRIBATIKOREA, DEMOCRATIC PEOPLE'S REPUBLIC OFKOREA, REPUBLIC OFKUWAITKYRGYZSTANLAO PEOPLE'S DEMOCRATIC REPUBLICLATVIALEBANONLESOTHOLIBERIALIBYAN ARAB JAMAHIRIYALIECHTENSTEINLITHUANIALUXEMBOURGMACAOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OFMADAGASCARMALAWIMALAYSIAMALDIVESMALIMALTAMARSHALL ISLANDSMARTINIQUEMAURITANIAMAURITIUSMAYOTTEMEXICOMICRONESIA, FEDERATED STATES OFMOLDOVA, REPUBLIC OFMONACOMONGOLIAMONTSERRATMOROCCOMOZAMBIQUEMYANMARNAMIBIANAURUNEPALNETHERLANDSNETHERLANDS ANTILLESNEW CALEDONIANEW ZEALANDNICARAGUANIGERNIGERIANIUENORFOLK ISLANDNORTHERN MARIANA ISLANDSNORWAYOMANPAKISTANPALAUPALESTINIAN TERRITORY, OCCUPIEDPANAMAPAPUA NEW GUINEAPARAGUAYPERUPHILIPPINESPITCAIRNPOLANDPORTUGALPUERTO RICOQATARREUNIONROMANIARUSSIAN FEDERATIONRWANDASAINT HELENASAINT KITTS AND NEVISSAINT LUCIASAINT PIERRE AND MIQUELONSAINT VINCENT AND THE GRENADINESSAMOASAN MARINOSAO TOME AND PRINCIPESAUDI ARABIASENEGALSERBIA AND MONTENEGROSEYCHELLESSIERRA LEONESINGAPORESLOVAKIASLOVENIASOLOMON ISLANDSSOMALIASOUTH AFRICASOUTH GEORGIA AND THE SOUTH SANDWICH ISLANDSSPAINSRI LANKASUDANSURINAMESVALBARD AND JAN MAYENSWAZILANDSWEDENSWITZERLANDSYRIAN ARAB REPUBLICTAIWAN, PROVINCE OF CHINATAJIKISTANTANZANIA, UNITED REPUBLIC OFTHAILANDTIMOR-LESTETOGOTOKELAUTONGATRINIDAD AND TOBAGOTUNISIATURKEYTURKMENISTANTURKS AND CAICOS ISLANDSTUVALUUGANDAUKRAINEUNITED ARAB EMIRATESUNITED KINGDOMUNITED STATESUNITED STATES MINOR OUTLYING ISLANDSURUGUAYUZBEKISTANVANUATUVENEZUELAVIET NAMVIRGIN ISLANDS, BRITISHVIRGIN ISLANDS, U.S.WALLIS AND FUTUNAWESTERN SAHARAYEMENZAMBIAZIMBABWE

State *

Choose your state AlabamaAlaskaArizonaArkansasCaliforniaColoradoConnecticutDelawareFloridaGeorgiaHawaiiIdahoIllinoisIndianaIowaKansasKentuckyLouisianaMaineMarylandMassachusettsMichiganMinnesotaMississippiMissouriMontanaNebraskaNevadaNew HampshireNew JerseyNew MexicoNew YorkNorth CarolinaNorth DakotaOhioOklahomaOregonPennsylvaniaRhode IslandSouth CarolinaSouth DakotaTennesseeTexasUSAF, AmericasUSAF, EuropeUSAF, PacificUtahVermontVirginiaWashingtonWashington DCWest VirginiaWisconsinWyoming

Get Your FREE Bottle

Learn about the trouble making vegetable, YES VEGETABLE... that can make your Arthritis worse. (And Make you feel 5 - 10 years older.)

The secret switch inside your body that you can flip to help make it start acting like it did when you were 25 years old.

The real reason why painkillers don't help your pain.

Which special superfood can actually counteract the damage or arthritis.

Adler A, Holub B. Effect of garlic and fish-oil supplementation on serum lipid and lipoprotein concentrations in hypercholesterolemic men. American Journal of Clinical Nutrition. 1997 Feb;65(2):445-50.

NIAMS, NIH, Bethesda, Maryland 20892, USA. Arthritis & Rheumatology (Impact Factor: 7.87).06/1998; 41(5):778-99. DOI: 10.1002/1529-0131(199805)41:5<778::AID-ART4>3.0.CO;2-V Source: PubMed

Hrlimann, David, Frank Enseleit, and Priv-Doz Dr Frank Ruschitzka. Rheumatoide arthritis, inflammation und atherosklerose. Herz 29.8 (2004): 760-768.

Schett, Georg. Rheumatoid arthritis: inflammation and bone loss. Wiener Medizinische Wochenschrift 156.1-2 (2006): 34-41.

Read the original:
5 Worst Foods for Arthritis and Joint Pain

Read More...

List of Rheumatoid Arthritis Medications (222 Compared …

Sunday, January 6th, 2019

methotrexate Rx X N X 94reviews

6.0

Generic name:methotrexate systemic

Brand names: Otrexup, Rasuvo, Rheumatrex Dose Pack, Trexall showall

Drug class: antimetabolites, antirheumatics, antipsoriatics, other immunosuppressants

For consumers: dosage, interactions,

For professionals: A-Z Drug Facts, AHFS DI Monograph, Prescribing Information

8.0

Generic name:celecoxib systemic

Drug class: cox-2 inhibitors

For consumers: dosage, interactions, side effects

For professionals: AHFS DI Monograph, Prescribing Information

6.0

Generic name:hydroxychloroquine systemic

Drug class: antirheumatics, antimalarial quinolines

For consumers: dosage, interactions, side effects

For professionals: AHFS DI Monograph, Prescribing Information

8.0

Generic name:prednisone systemic

Brand name: Rayos

Drug class: glucocorticoids

For consumers: dosage, interactions,

For professionals: A-Z Drug Facts, AHFS DI Monograph, Prescribing Information

7.0

Generic name:etanercept systemic

Drug class: antirheumatics, TNF alfa inhibitors

For consumers: dosage, interactions, side effects

For professionals: AHFS DI Monograph, Prescribing Information

6.0

Generic name:meloxicam systemic

Brand name: Mobic

Drug class: Nonsteroidal anti-inflammatory drugs

For consumers: dosage, interactions,

For professionals: A-Z Drug Facts, AHFS DI Monograph, Prescribing Information

6.0

Generic name:adalimumab systemic

Drug class: antirheumatics, TNF alfa inhibitors

For consumers: dosage, interactions, side effects

For professionals: AHFS DI Monograph, Prescribing Information

6.0

Generic name:hydroxychloroquine systemic

Brand name: Plaquenil

Drug class: antirheumatics, antimalarial quinolines

For consumers: dosage, interactions,

For professionals: A-Z Drug Facts, AHFS DI Monograph, Prescribing Information

7.0

Generic name:tocilizumab systemic

Drug class: interleukin inhibitors

For consumers: dosage, interactions, side effects

For professionals: AHFS DI Monograph, Prescribing Information

6.0

Generic name:leflunomide systemic

Drug class: antirheumatics, selective immunosuppressants

For consumers: dosage, interactions, side effects

For professionals: AHFS DI Monograph, Prescribing Information

5.0

Generic name:sulfasalazine systemic

Brand names: Sulfazine, Azulfidine, Azulfidine EN-tabs

Drug class: antirheumatics, 5-aminosalicylates

For consumers: dosage, interactions,

For professionals: A-Z Drug Facts, AHFS DI Monograph, Prescribing Information

8.0

Generic name:infliximab systemic

Drug class: antirheumatics, TNF alfa inhibitors

For consumers: dosage, interactions, side effects

For professionals: AHFS DI Monograph, Prescribing Information

6.0

Generic name:leflunomide systemic

Brand name: Arava

Drug class: antirheumatics, selective immunosuppressants

For consumers: dosage, interactions,

For professionals: A-Z Drug Facts, AHFS DI Monograph, Prescribing Information

6.0

Generic name:meloxicam systemic

Drug class: Nonsteroidal anti-inflammatory drugs

For consumers: dosage, interactions, side effects

For professionals: AHFS DI Monograph, Prescribing Information

6.0

Generic name:acetaminophen / hydrocodone systemic

Drug class: narcotic analgesic combinations

For consumers: dosage, interactions, side effects

For professionals: Prescribing Information

Off Label: Yes

5.0

Generic name:abatacept systemic

Drug class: antirheumatics, selective immunosuppressants

For consumers: dosage, interactions, side effects

For professionals: AHFS DI Monograph, Prescribing Information

9.0

Generic name:acetaminophen / hydrocodone systemic

Drug class: narcotic analgesic combinations

For consumers: dosage, interactions, side effects

For professionals: Prescribing Information

Off Label: Yes

7.0

Generic name:diclofenac systemic

Brand names: Voltaren, Cataflam, Voltaren-XR

Drug class: Nonsteroidal anti-inflammatory drugs

For consumers: dosage, interactions,

For professionals: A-Z Drug Facts, AHFS DI Monograph, Prescribing Information

Continued here:
List of Rheumatoid Arthritis Medications (222 Compared ...

Read More...

Arthritis (for Kids)

Sunday, January 6th, 2019

What Is Arthritis?

Arthritis (say: arth-ry-tiss) is a disease that causes swelling, stiffness, and pain in a person's joints.Joints are where two bones meet, allowing our bodies to move the hips, knees, ankles, elbows, shoulders, knuckles, etc. Joints contain synovial fluid, which acts as a lubricant to help them move easily.Arthritis can keep joints from working properly.

But isn't arthritis something that only old people get?

Actually, kids can get a kind of arthritis called juvenile idiopathic arthritis or JIA (it's also called juvenile rheumatoid arthritis, or JRA). Juvenile means young, so this means that JIA is different from the arthritis that adults get. Kids can have many different types of arthritis, but JIA is the most common.

Many problems can cause pain and swelling of the joints, so a doctor will want to know how long these problems have been going on. To be considered JIA, the joints must have swelling and pain for at least 6 weeks.

No one really knows what causes JIA. Something in the environment, like a virus, may trigger the disease in kids that already have certain genes that make it more likely for them to get it. (Genes are like instructions to the body on how to work. Genes are passed on from parents to their children and they decide everything from the color of a person's eyes to whether that person has a tendency to get a particular disease. Genes are part of our DNA and are found in the body's cells.)

JIA is not contagious, so you can't catch it from someone else.

Arthritis is an autoimmune (say: aw-toe-i-myoon) disease. An autoimmune disease means a person's immune system makes a mistake and attacks the body's own tissues or organs. Normally, a kid's immune system sends out white blood cells to protect the body and fight outside invaders like bacteria and viruses that can make a kid sick. But with an autoimmune disease like JIA, the immune system makes a mistake and attacks healthy cells.

Instead of recognizing the healthy cells and saying, "Hi, nice to see you," the immune system thinks the healthy cells need to be destroyed and releases chemicals to fight the healthy cells. The chemicals released by the immune system cause the pain and swelling that can happen with arthritis.

Just because a joint hurts doesn't mean a kid has JIA. A joint might hurt for a lot of different reasons, which is why it's important to see a doctor to figure out what the problem is.

The doctor will ask a lot of questions: How long has the kid had joint problems? Does he or she feel stiff when getting up or after resting? Are the joints swollen? Was there an injury? Could another problem be causing arthritis, such as Lyme disease? Is there a family history of arthritis or other autoimmune diseases?

Getting these answers and doing a physical exam, blood tests, and X-rays will help the doctor figure out if it is JIA. If your doctor thinks you may have it, he or she may send you to see a doctor who specializes in the diagnosis and treatment of arthritis. This kind of doctor is called a rheumatologist (say: roo-muh-tol-oh-jist).

Some kids who have JIA might take medicine like ibuprofen to help control pain and inflammation. If the arthritis is more severe, they may need to take other medicines to help lower the pain and inflammation. Some of these medicines are pills, but others are shots.

It's important that kids with JIA keep their joints moving. Often a kid will see a physical therapist or occupational therapist. In addition to working with children to move their joints and strengthen their muscles, these therapists can help create special exercise programs for home or school that can help a kid stay active.

In addition to joint problems, JIA may cause uveitis (say: yoo-vee-eye-tus), an inflammation of the eye that can lead to problems with vision if it's not treated. All kids diagnosed with JIA should get their eyes checked by an ophthalmologist, a doctor who specializes in diagnosing and treating eye problems. If the eyes are affected, they may be treated with eye drops.

Besides taking medicines, akid can do a few things to help with the symptoms of JIA:

Kids with JIA can have a lot of stiffness when they first wake up in the morning. Once their joints warm up, they can usually move more easily. That's why you might notice that someone with JIA has trouble moving early in the day, but seems better later on.

It's important to find a good balance between activity (which helps kids stay flexible) and rest (which everyone needs). Swimming is a great exercise for someone with JIA. It stretches a lot of different muscles and tendons and helps keep a kid moving and flexible. It's important to stay active even when a kid isn't having symptoms.

Sometimes kids with JIA can go a long time, even months or years, without the disease bothering them. Then it comes back. This is called a flare-up or flare. Flare-ups just happen and can't be prevented. It can be frustrating if a flare-up happens on a day when the kid would like to be doing something fun, like attending a birthday party.

If you know someone with JIA, you may offer to carry books or give other help, if needed. It's also OK if the person doesn't want help.

The good news is that many kids with JIA will outgrow it. About half of kids with JIA may not need treatment as adults.

And even when the arthritis flares up, almost all kids with JIA can control it with medicine and other treatments, which means they can do most things that other kids can do.

Date reviewed: April 2016

View post:
Arthritis (for Kids)

Read More...

Arthritis – pcrm.org

Sunday, January 6th, 2019

Arthritis is a group of diseases that cause painful and swollen joints. Osteoarthritis typically develops gradually and can cause pain and stiffness. Rheumatoid arthritis (RA) is more aggressive and occurs when the body attacks the joints. RA causes painful, inflamed joints and can result in permanent damage. Certain genes also make some people more likely to develop RA.

If you have RA, a diet change could help you, and perhaps even eliminate your pain entirely. In research studies, many people who cut out certain trigger foods find that their pain improves or goes away. The reason, presumably, is that certain foods spark inflammation in the joints. When those foods are gone, so is the inflammation.

A survey of more than 1,000 arthritis patients revealed that red meat, sugar, fat, salt, caffeine, and nightshade plants (e.g., tomatoes, eggplant) most commonly worsen the condition. Research also shows that dairy protein may make symptoms worse.

One study looked at the effects of a very low-fat vegan diet on people with moderate-to-severe RA. After only four weeks on the diet, people had significant improvements in morning stiffness, RA pain, joint tenderness, and joint swelling.

People with osteoarthritis can also benefit from dietary changes. A 2015 study found that people eating a whole-food, plant-based diet significantly decreased their osteoarthritis painin just two weeks. By the end of the six-week study, they reported more energy and better physical functioning, too.

Another study found that a high-fiber diet lowers the risk for knee osteoarthritis by up to 61 percent.

Why Does it Work?

Plant-based diets are often lower in fat and contain different kinds of fat than diets with animal products. For example, many whole plant foods have an optimal ratio of omega-6 to omega-3 fats. Healthful weight loss from eating a vegan diet is also anti-inflammatory, further helping cool irritated joints.

Here's how to get started with pain-safe foods.For two weeks:

If your diet change makes your pain disappear or improve, the next step is to find out which foods are your triggers. To do this, simply reintroduce the eliminated foods one at a time, every two days, to see whether any symptoms result.

Pain-Safe Foods

Pain-safe foods virtually never contribute to arthritis, headaches, or other painful conditions. These include:

Common Pain Triggers

Common triggers often cause pain in susceptible people. Certain drinks and additives are also common triggers, including alcoholic beverages (especially red wine), caffeinated drinks (coffee, tea, and colas), monosodium glutamate, aspartame (NutraSweet), and nitrites. Here are the common food triggers, also known as the "Dirty Dozen":

Excerpt from:
Arthritis - pcrm.org

Read More...

Knee Arthritis Diagnosis and Treatment – verywellhealth.com

Sunday, January 6th, 2019

Arthritis of the knee joint is one of the most common causes of knee pain. There are different types of arthritis that can affect the knee joint, and the treatments may vary depending on the specific condition that is causing the symptoms.

Osteoarthritis is the most common type of knee arthritis. Also called wear-and-tear arthritis or degenerative joint disease, osteoarthritis is characterized by progressive wearing away of the cartilage in the joint. As the protective cartilage is worn away, bone is exposed, the knee becomes swollen, and activities become increasingly painful.

Knee arthritis symptoms tend to gradually progress as the condition worsens, however, symptoms may suddenly worsen with minor injury or overuse. Some patients report long episodes of mild symptoms, with sudden changes that increase the severity of their symptoms. Often patients report good months and bad months, or symptoms that fluctuate with the weather. This is important to understand because comparing the symptoms of arthritis on one particular day may not accurately represent the overall progression of the condition. Since there is not a cure for arthritis, learning ways to slow the progression of arthritis is also important.

Treatment should begin with the most basic steps and progress to the more invasive, possibly including surgery. Not all treatments are appropriate for every patient, and you should have a discussion with your doctor to determine which treatments are appropriate for your particular situation. The range of options includes:

See the rest here:
Knee Arthritis Diagnosis and Treatment - verywellhealth.com

Read More...

In the Kitchen with Arthritis: Foods to Avoid

Sunday, January 6th, 2019

You may not be thinking much about your arthritis as youre walking down the grocery store aisles or looking at a restaurant menubut maybe you should start.

This tasty recipe involves cauliflower, a great anti-inflammatory vegetable Video: Parmesan & Balsamic Vinegar Roasted Cauliflower for Arthritis Pain Relief

There are several types of foods known to either promote or suppress inflammation in our bodies. If you seek out the anti-inflammatory options and avoid the inflammatory options, you may be able to ease arthritis pain and symptoms.

See What Are Anti-Inflammatory Foods?

Heres a guide to the food choices you should steer clear of in order to help your arthritis.

See Integrative Arthritis Therapies and Nutrition

Article continues below

Avoid processed foods such as baked goods and prepackaged meals and snacks. These items contain trans fats to help preserve them, and trans fats trigger systemic inflammation. To dodge trans fats, avoid any foods labeled as containing partially hydrogenated oils.

See Foods to Avoid with Fibromyalgia

Foods that contain refined sugarincluding pastries, chocolate, candy, soda, and even fruit juicestrigger the release of proteins in the body called cytokines, which cause inflammation. Sugar is labeled many ways in food items; in addition to sugar, watch for corn syrup, fructose, sucrose, or maltose in the ingredient list.

Meatespecially red meatis high in saturated fats, which cause high cholesterol and inflammation. On top of this, meat also contains high levels of advanced glycation end products (AGEs) that stimulate inflammation, particularly when meat is cooked by broiling, grilling, roasting, or frying it.1

Its not just fried chicken you should avoid, though. Other fried foods, such as donuts and French fries, contain trans fats in addition to AGEs.

See An Anti-Inflammatory Diet for Arthritis

This includes white bread, white pasta, and crackers. Refined grains (as opposed to whole grain products) cause a spike in blood glucose level, which has been shown to increase levels of several inflammation-markers in the body.

Another factor to consider about grains: People with gluten sensitivities may experience joint pain and inflammation from consuming wheat products.

See How Gluten Can Cause Joint Pain

Cheese, butter, cream cheese, margarine, and mayonnaise are all high is both saturated fats and AGEstheyre big inflammation triggers and should be consumed sparingly.

Corn, peanut, sunflower, safflower, and soy oils are high in omega-6 fatty acids, which are healthy in small doses. But excessive omega-6 consumption can trigger inflammatory chemicals.

This is not the case for the types of oils rich in omega-3 fatty acids, such as olive, canola, and flaxseed oils. These varieties are healthy, even in larger amounts.

See The Ins and Outs of an Anti-Inflammatory Diet

Avoiding foods and drinks that trigger inflammation is not just good for your arthritis. An anti-inflammatory diet can also help prevent other chronic conditions like heart disease and diabetes.

See Ingredients That May Trigger Fibromyalgia Symptoms

Before you despair that everything tasty seems to be off-limits if you want to practice an anti-inflammatory diet, keep in mind that a few simple swaps can often make the difference between healthy and unhealthy food choices. For example, cook with canola oil instead of corn oil, or swap out white bread for whole grain bread.

Managing RA Fatigue Through Diet and Exercise

Gout Prevention Diet

Read the original post:
In the Kitchen with Arthritis: Foods to Avoid

Read More...

TYLENOL 8-HR Arthritis Pain | TYLENOL

Sunday, January 6th, 2019

TYLENOL 8-HR Arthritis Pain | TYLENOLSkip to main content

Works fast and lasts all day, up to 8 hours.Available as caplets.

Enroll in a program to help you on your journey and get personalized support.

Get the facts about joint pain and osteoarthritis.

This website contains current product information and may differ from the information on the product packaging you may have.

Enroll in a program to help you on your journey and get personalized support.

Get the facts about joint pain and osteoarthritis.

Review Questions:

Tylenol is the brand I prefer for fast, effective pain relief.:Yes

Review Text:

Fast relief recommended by dr. Best thing ever for me would recommend it to anyone and everyone who has arthritis

Recommended:

Yes, I'd recommend this product

Overall:

12345

Helpfulness:

Was this review helpful to you?

Review Questions:

Tylenol is the brand I prefer for fast, effective pain relief.:Yes

Review Text:

Life saver! I find that when I take one Tylenol Arthritis with one Aleve, I have a good 7/8 hours Pain Free From My Rgeumatoid Arthritis. I asked my doctor if it was safe for me to take and he said YES!! When I have a bad flare, I might need stronger medication but this works very well! Im trying to just take this along with herbal supplements for my arthritis

Recommended:

Yes, I'd recommend this product

Overall:

12345

Helpfulness:

Was this review helpful to you?

Review Questions:

Tylenol is the brand I prefer for fast, effective pain relief.:Yes

Review Text:

Tylenol 8hr. Arthritis formula was more effective at controlling my pain than most of the medications the doctor prescribed for me after I hurt my lower back and had sciatica in my left leg for about a year.

Recommended:

Yes, I'd recommend this product

Overall:

12345

Helpfulness:

Was this review helpful to you?

Review Questions:

Tylenol is the brand I prefer for fast, effective pain relief.:No

Review Text:

I think Tylenol is good for some headaches, but it doesnt seem to touch the pain when its muscular or for joints. I have arthritis in my hands and lower back. It really was almost like I had taken nothing. I kept taking it, hoping that it needed to build up in my system or something. Ibrupophen seems to work better for those kind of pains. I cant take those anymore due to stomach issues. Is Tylenol even for inflammation? What makes this good for arthritis? The high dosage amount? I had high hopes. That was just a waste of money.

Recommended:

Yes, I'd recommend this product

Overall:

12345

Client Responses:

Thanks for your feedback! We're so sorry to hear you haven't been feeling relief, and we want to learn more. Give us a call at 1-877-895-3665, we're here from 9AM to 5:30PM ET Monday through Friday. Hope to hear from you soon!

Helpfulness:

Was this review helpful to you?

Review Questions:

Tylenol is the brand I prefer for fast, effective pain relief.:No

Review Text:

I took two for Arthritis pain it never helped. The only reason I'm taking Tylenol is because my doctor said it was better for me than another brand I was taking that did work for me.

Recommended:

No, I would not recommend this product

Overall:

12345

Client Responses:

Hi there, thanks for leaving your review! We're sorry to hear you didn't find relief with this product, so we'd like to learn more and help make it up to you. Please give us a call at 1-877-895-3665 from 9AM - 5:30PM ET, Monday through Friday. Hope to hear from you soon!

Helpfulness:

Was this review helpful to you?

Review Text:

yeah! thanks for sharing this information. here I want to share About homeopathy treatment for Arthritis. Arthritis is a term often used to mean any disorder that affects joints. A joint is an area, where two different bones meet. I suggest livehomeo is the best clinics information for Arthritis treatment. visit for more details : https://www.livehomeo.com/treatments/fight-arthritis-fatigue/

Recommended:

Yes, I'd recommend this product

Location:

Hyderabad, Telangana, India

Overall:

12345

Review Questions:

Tylenol is the brand I prefer for fast, effective pain relief.:No

Review Text:

This product works well on pain but the side effects are too severe on the stomach.

Recommended:

No, I would not recommend this product

Overall:

12345

Client Responses:

We're sorry to hear this and we'd like to learn more! Please give us a call at 1-877-895-3665 from 9AM - 5:30PM ET, Monday through Friday. Thank you!

Helpfulness:

Was this review helpful to you?

Review Questions:

Tylenol is the brand I prefer for fast, effective pain relief.:Yes

Review Text:

Does this work for night time pain? Is there a Tylenol pm for arthritis?

Overall:

12345

Helpfulness:

Was this review helpful to you?

Log in using your account with

By registering, you agree to receive additional communications regarding product information, promotions, newsletters and surveys from our site. If you choose to register with a social provider, certain information will be shared by your social provider with our site.

{* traditionalSignIn_signInButton *}

Welcome back, {* welcomeName *}!

Welcome back!

{* traditionalSignIn_signInButton *}

All Fields required, unless otherwise indicated

Will be used as your user name

By submitting your information above, you agree that the information you provide will be governed by our site's Privacy Policy.

By submitting your information you agree to our sites Privacy Policy.

All fields required unless otherwise indicated

See more here:
TYLENOL 8-HR Arthritis Pain | TYLENOL

Read More...

The 5 Worst Foods To For Arthritis

Friday, January 4th, 2019

This video player is not support on your device, please click HERE to try a different player. We apologize for this inconvenience.

*Results will vary based on how long and how closely you follow the information presented, as well as other individual biological factors.

How long would YOU like to be pain free?

Look, I know you're skeptical. You should be. Look at all the big drug companies who are lying to you each and every day trying to convince you that their dangerous (sometimes deadly!) drugs are safe.

So I thought there's no better way for you to find out if Heal-n-Soothe will work for you, than having you try it. And that's why I'd like to send you a 90 count bottle, a 30 day supply, for free. You just pay the shipping and handling.

No matter what your arthritis pain level and frequency, fill out the risk-free acceptance form below to see how well Heal-n-Soothe will work for you.

STEP 1: Where Should We Ship Your FREE Bottle?

Country *

Choose your country AFGHANISTANALBANIAALGERIAAMERICAN SAMOAANDORRAANGOLAANGUILLAANTARCTICAANTIGUA AND BARBUDAARGENTINAARMENIAARUBAAUSTRALIAAUSTRIAAZERBAIJANBAHAMASBAHRAINBANGLADESHBARBADOSBELARUSBELGIUMBELIZEBENINBERMUDABHUTANBOLIVIABOSNIA AND HERZEGOVINABOTSWANABOUVET ISLANDBRAZILBRITISH INDIAN OCEAN TERRITORYBRUNEI DARUSSALAMBULGARIABURKINA FASOBURUNDICAMBODIACAMEROONCANADACAPE VERDECAYMAN ISLANDSCENTRAL AFRICAN REPUBLICCHADCHILECHINACHRISTMAS ISLANDCOCOS (KEELING) ISLANDSCOLOMBIACOMOROSCONGOCONGO, THE DEMOCRATIC REPUBLIC OF THECOOK ISLANDSCOSTA RICACOTE D'IVOIRECROATIACUBACYPRUSCZECH REPUBLICDENMARKDJIBOUTIDOMINICADOMINICAN REPUBLICECUADOREGYPTEL SALVADOREQUATORIAL GUINEAERITREAESTONIAETHIOPIAFALKLAND ISLANDS (MALVINAS)FAROE ISLANDSFIJIFINLANDFRANCEFRENCH GUIANAFRENCH POLYNESIAFRENCH SOUTHERN TERRITORIESGABONGAMBIAGEORGIAGERMANYGHANAGIBRALTARGREECEGREENLANDGRENADAGUADELOUPEGUAMGUATEMALAGUINEAGUINEA-BISSAUGUYANAHAITIHEARD ISLAND AND MCDONALD ISLANDSHOLY SEE (VATICAN CITY STATE)HONDURASHONG KONGHUNGARYICELANDINDIAINDONESIAIRAN, ISLAMIC REPUBLIC OFIRAQIRELANDISRAELITALYJAMAICAJAPANJORDANKAZAKHSTANKENYAKIRIBATIKOREA, DEMOCRATIC PEOPLE'S REPUBLIC OFKOREA, REPUBLIC OFKUWAITKYRGYZSTANLAO PEOPLE'S DEMOCRATIC REPUBLICLATVIALEBANONLESOTHOLIBERIALIBYAN ARAB JAMAHIRIYALIECHTENSTEINLITHUANIALUXEMBOURGMACAOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OFMADAGASCARMALAWIMALAYSIAMALDIVESMALIMALTAMARSHALL ISLANDSMARTINIQUEMAURITANIAMAURITIUSMAYOTTEMEXICOMICRONESIA, FEDERATED STATES OFMOLDOVA, REPUBLIC OFMONACOMONGOLIAMONTSERRATMOROCCOMOZAMBIQUEMYANMARNAMIBIANAURUNEPALNETHERLANDSNETHERLANDS ANTILLESNEW CALEDONIANEW ZEALANDNICARAGUANIGERNIGERIANIUENORFOLK ISLANDNORTHERN MARIANA ISLANDSNORWAYOMANPAKISTANPALAUPALESTINIAN TERRITORY, OCCUPIEDPANAMAPAPUA NEW GUINEAPARAGUAYPERUPHILIPPINESPITCAIRNPOLANDPORTUGALPUERTO RICOQATARREUNIONROMANIARUSSIAN FEDERATIONRWANDASAINT HELENASAINT KITTS AND NEVISSAINT LUCIASAINT PIERRE AND MIQUELONSAINT VINCENT AND THE GRENADINESSAMOASAN MARINOSAO TOME AND PRINCIPESAUDI ARABIASENEGALSERBIA AND MONTENEGROSEYCHELLESSIERRA LEONESINGAPORESLOVAKIASLOVENIASOLOMON ISLANDSSOMALIASOUTH AFRICASOUTH GEORGIA AND THE SOUTH SANDWICH ISLANDSSPAINSRI LANKASUDANSURINAMESVALBARD AND JAN MAYENSWAZILANDSWEDENSWITZERLANDSYRIAN ARAB REPUBLICTAIWAN, PROVINCE OF CHINATAJIKISTANTANZANIA, UNITED REPUBLIC OFTHAILANDTIMOR-LESTETOGOTOKELAUTONGATRINIDAD AND TOBAGOTUNISIATURKEYTURKMENISTANTURKS AND CAICOS ISLANDSTUVALUUGANDAUKRAINEUNITED ARAB EMIRATESUNITED KINGDOMUNITED STATESUNITED STATES MINOR OUTLYING ISLANDSURUGUAYUZBEKISTANVANUATUVENEZUELAVIET NAMVIRGIN ISLANDS, BRITISHVIRGIN ISLANDS, U.S.WALLIS AND FUTUNAWESTERN SAHARAYEMENZAMBIAZIMBABWE

State *

Choose your state AlabamaAlaskaArizonaArkansasCaliforniaColoradoConnecticutDelawareFloridaGeorgiaHawaiiIdahoIllinoisIndianaIowaKansasKentuckyLouisianaMaineMarylandMassachusettsMichiganMinnesotaMississippiMissouriMontanaNebraskaNevadaNew HampshireNew JerseyNew MexicoNew YorkNorth CarolinaNorth DakotaOhioOklahomaOregonPennsylvaniaRhode IslandSouth CarolinaSouth DakotaTennesseeTexasUSAF, AmericasUSAF, EuropeUSAF, PacificUtahVermontVirginiaWashingtonWashington DCWest VirginiaWisconsinWyoming

Get Your FREE Bottle

Learn about the trouble making vegetable, YES VEGETABLE that can make your Arthritis worse. (And Make you feel 5 - 10 years older.)

The secret switch inside your body that you can flip to help make it start acting like it did when you were 25 years old.

The real reason why pain killers don't help your pain.

Which special superfood can actually counteract the damage or arthritis.

Adler A, Holub B. Effect of garlic and fish-oil supplementation on serum lipid and lipoprotein concentrations in hypercholesterolemic men. American Journal of Clinical Nutrition. 1997 Feb;65(2):445-50.

NIAMS, NIH, Bethesda, Maryland 20892, USA. Arthritis & Rheumatology (Impact Factor: 7.87).06/1998; 41(5):778-99. DOI: 10.1002/1529-0131(199805)41:5<778::AID-ART4>3.0.CO;2-V Source: PubMed

Hrlimann, David, Frank Enseleit, and Priv-Doz Dr Frank Ruschitzka. Rheumatoide arthritis, inflammation und atherosklerose. Herz 29.8 (2004): 760-768.

Schett, Georg. Rheumatoid arthritis: inflammation and bone loss. Wiener Medizinische Wochenschrift 156.1-2 (2006): 34-41.

See the article here:
The 5 Worst Foods To For Arthritis

Read More...

Avoid This Unnecessary Surgery – LewRockwell

Tuesday, January 1st, 2019

By Dr. Mercola

Arthroscopic knee surgery is one of the most common unnecessary surgeries performed todayalong with back and hip surgeries, pacemakers, cardiac angioplasties, hysterectomies, and Cesarean sections.

Several studies over the past decade have highlighted questions about arthroscopic knee surgery, and now, you can add one more to the pile. The meniscus inside your knee is a thin crescent-shaped disc of cartilage that serves as a cushion between your femur and tibia and helps stabilize your knees.

Over time, your meniscus can develop tears, especially if you have arthritis. The standard orthopedic surgeons intervention for meniscal tears is performing an arthroscopic partial meniscectomytrimming the torn meniscus and smoothing the jagged edges of what remains, which assumes the tear is whats causing your pain. However, that may be a faulty assumption.

This is a Flash-based video and may not be viewable on mobile devices.

Visit the Mercola Video Library

Knee Surgery No Better Than ShamBioAstin Hawaiian Asta...Buy New $23.97(as of 02:10 EST - Details)

This latest study, conducted in Finland, examined 146 patients with degenerative meniscal tears (caused by wear and tear, not acute injury).1Researchers divided patients into two groups.

One group received the standard surgery, and the other received a sham surgeryin other words, a fake or placebo intervention where no actual surgery takes place. The study excluded people with knee arthritis, because they tend not to benefit as much from meniscus surgery and the researchers wanted to ascertain if the surgery helps under ideal circumstances.2

The sham surgery involved the physicians making an incision and poking around without any actual cartilage shaving or cutting. Many of the patients were given epidural anesthesia, so they were awake, making it necessary for surgical staff to use their theatrical talents to pull off a believable sham surgery.

The outcome? One year later, both groups reported equally favorable responses to the procedureprimarily, reduction in knee pain. In the end, the researchers concluded that the real knee surgeries offered no better outcomes than the sham surgeries.

Arthroscopic surgery on the meniscus is the most common orthopedic procedure in the US, and according to this study, is performed about 700,000 times a year to the tune of $4 billion. Any surgeon who tells you this is the best or only option for your osteoarthritic knee pain will not have a leg to stand on when you show him or her all of the evidence to the contrary.

Arthroscopic Surgeries Have an Embarrassing Track Record

Prior to the Finnish study, there were already three prior studies of note that should have orthopedic surgeons rethinking how they treat their knee patients:

See the pattern emerging here? Its hard to miss! Eighty percent of meniscal tears develop from wear and tear over time.6If you have pain in your knees from ordinary activities or arthritis, you may be better off skipping the surgery and going straight to physical therapy.

Or better yet, get some treatments with an infrared laser that I discussed in detail withDr. Harrington.

Of course, there are other non-invasive therapies that can be helpful as well. But its becoming quite clear that a torn meniscusat least, the wear-and-tear varietyis not going to be helped by a surgical trim. Surgeries come with all sorts of risks, and there is no point in exposing yourself to these without some clear advantage.

If you have a torn meniscus from an accident or injury, the scenario may be different, but I would still recommend you getting a second or even third opinion before going under the knife.

The Power of Placebo

With TWO studies now highlighting the benefits of placebo knee surgeries, the power ofplacebojust cant be ignored. Placebos typically have far fewer side effects (if any) than prescription drugs, injections, or actual surgeriesand they often work just as well as the standard of care.Studies have shown that if youthinkyoure receiving a treatment, and you expect that treatment to work, it often doeseven if you know youre receiving aplacebo.

This was beautifully demonstrated in the Finnish studythe knee surgery patients knew they might be having a sham surgery, yet they experienced the benefits anyway. But how do placebos work? How can your brain produce healing just because youbelieveit should be happening?Although the exact mechanisms of the placebo effect are not well understood, it seems related to changes in your brain in response to different psychosocial stimuli. Areas of your brain associated with expectations, anxiety, and rewards seem to be involved.Scientific Americanreported:7

In recent decades reports have confirmed the efficacy of various sham treatments in nearly all areas of medicine. Placebos have helped alleviate pain, depression, anxiety, Parkinsons disease, inflammatory disorders and even cancer.

Placebo effects can arise not only from a conscious belief in a drug but also from subconscious associations between recovery and the experience of being treatedfrom the pinch of a shot to a doctors white coat.Such subliminal conditioning can control bodily processes of which we are unaware, such as immune responses and the release of hormones Researchers have decoded some of the biology of placebo responses, demonstrating that they stem from active processes in the brain.

You can tap into your own placebo effect with techniques such asEFT or Emotional Freedom Technique.This is a new way of thinking about healing for most people that can be extremely powerful, especially when combined with a positive outlook and a proactive,disease-preventive lifestyle.

Your Secret Weapon Against Knee Pain: Exercise

Exercise is the real medicine for pain in your joints.Exercisehelps prevent and relieve joint pain through a number of mechanisms, including strengthening key supportive muscles, improving flexibility and range of motion, improving bone strength, and helping you optimize your weight. The notion that exercise is detrimental to your joints is a serious misconception; there is no evidence to support this belief. Its simply a myth that you can wear down your knees just from average levels of exercise and/or normal activity.

This is not to say that traditional pavement-pounding, likedistance running, is going to be of any benefit to your kneesIm talking about low-impact but effective exercise, such ashigh-intensity interval training (HIIT),high-intensity cardio,weight training,stretching, and core work. If you find youre in pain for more than an hour after your workout, you should slow down or choose another form of exercisethere really are plenty to choose from.

If youve already developed osteoarthritis in your knees, youll want to incorporate exercises that strengthen your quadriceps muscle at the front of your thigh. And, rather than running and other high-impact activities, you may be better off with non-weight-bearing exercises like swimming and cycling. Strengthening and stretching the areas around, above, and below your knee is key to reducing most knee pain, which is the goal of the exercises I demonstrate in the video above. I recommend a qualified physiotherapist to properly assist you with your exercises to avoid injury. Make sure to wear appropriate footwear for all of your daily activities. Spiked heels and very flat soled shoes place unnatural stresses on your knees. Goodpostureis important as well.

For joint pain, many physicians commonly recommend anti-inflammatory drugs (non-steroidal anti-inflammatories or NSAIDs) and analgesics (such as Tylenol) to their osteoarthritis patients. I dont recommend the chronic use of these drugs due to significant side effects, which may include kidney and/or liver damage. There are safer and more effective natural options for relieving joint pain. Although popular, I am also not much of aglucosamine and chondroitinfan because studies have failed to demonstrate their effectiveness. However, there are some very effective natural remedies that are truly backed up by science. The following are my favorites:

Sun exposure is your best option, because your skin produces two types of sulfur in response to sun exposure: cholesterol sulfate and vitamin D3 sulfate. Sulfur plays a vital role in the structure and biological activity of both proteins and enzymes. If you dont have sufficient sulfur in your body, this deficiency can create a number of health problems, including negative impacts on your joints and connective tissue. Which brings us to the next item

Methylsulfonylmethane (known asMSM) is another alternative you might find helpful. MSM is an organic form of sulfur and a potent antioxidant naturally found in many plants, and is available in supplement form. For more on the benefits of MSM, I recommend listening to this interview.

Eggshell membrane also contains transforming growth factor-B, a protein that helps with tissue rejuvenation, in addition to other amino acids and structural components that provide your joints with the building blocks they need to build cartilage.

Sources and References

The Best of Joseph Mercola

See more here:
Avoid This Unnecessary Surgery - LewRockwell

Read More...

Arthritis | Causes, symptoms, treatment | Versus Arthritis

Sunday, November 4th, 2018

Having a good understanding of your condition will help you know about your treatment options and why exercise and other self-management methods are important. It will also mean youre in a good position to get the most out of your appointments with healthcare professionals.

If youre ever struggling with any aspects of managing your arthritis, or notice new symptoms, you should see a GP. They could also refer you to another relevant healthcare professional.

This could include a physiotherapist, who is trained to help you with exercise and help you maintain movement and function of any part of your body affected by arthritis.

Alternatively, you might benefit from seeing an occupational therapist. These are professionals who could help you overcome the difficulties that your condition might cause, by providing practical solutions.

You can be referred to physiotherapists and occupational therapists on the NHS through your GP. If you are struggling with every-day tasks at home, you may be able to get access to an occupational therapist through your local social services department.

Or you can search for private physiotherapists and occupational therapists near you through the following websites:

Its difficult to say for certain how arthritis will affect you over time. In some types of arthritis symptoms can come and go.

Most people with arthritis dont have major mobility problems, and effective treatment will help reduce the risk of joint damage, even in more severe cases.

There is plenty you can do to remain positive and proactive in all aspects of managing your arthritis and your overall health.

If youre worried about what impact arthritis will have on your working life, its important to know that you have rights and options.

If you work your arthritis might mean that you need to change aspects of your job or even train for a different role.

Your employer has a duty to make sure that your arthritis doesnt make it difficult for you to do your job, or that youre uncomfortable at work. Having a chat with your manager about your condition, how it affects you, and how your employer might be able to help you is a useful first step to unlock the rights and support youre entitled to by law.

Being in pain from arthritis can often lead to anxiety and depression. Its important to tackle feelings like this, because they can affect how well you manage your condition.

Talking to your partner, relative, friend, or a doctor can really help. You might find it helpful to try something like cognitive behaviour therapy, or mindfulness. These are talking therapies that have helped people cope better with the effects of arthritis.

If you have arthritis it does have the potential to have an impact on your quality of life. However, with the right treatment, support, knowledge and approach, you will be able to live a fulfilling, happy and successful life.

The more youre able to stay physically and socially active the more control youll have over your life, and the less control arthritis will have over you.

Link:
Arthritis | Causes, symptoms, treatment | Versus Arthritis

Read More...

Page 47«..1020..46474849..6070..»


2025 © StemCell Therapy is proudly powered by WordPress
Entries (RSS) Comments (RSS) | Violinesth by Patrick