header logo image


Page 41234

Archive for January, 2019

In the Kitchen with Arthritis: Foods to Avoid

Sunday, January 6th, 2019

You may not be thinking much about your arthritis as youre walking down the grocery store aisles or looking at a restaurant menubut maybe you should start.

This tasty recipe involves cauliflower, a great anti-inflammatory vegetable Video: Parmesan & Balsamic Vinegar Roasted Cauliflower for Arthritis Pain Relief

There are several types of foods known to either promote or suppress inflammation in our bodies. If you seek out the anti-inflammatory options and avoid the inflammatory options, you may be able to ease arthritis pain and symptoms.

See What Are Anti-Inflammatory Foods?

Heres a guide to the food choices you should steer clear of in order to help your arthritis.

See Integrative Arthritis Therapies and Nutrition

Article continues below

Avoid processed foods such as baked goods and prepackaged meals and snacks. These items contain trans fats to help preserve them, and trans fats trigger systemic inflammation. To dodge trans fats, avoid any foods labeled as containing partially hydrogenated oils.

See Foods to Avoid with Fibromyalgia

Foods that contain refined sugarincluding pastries, chocolate, candy, soda, and even fruit juicestrigger the release of proteins in the body called cytokines, which cause inflammation. Sugar is labeled many ways in food items; in addition to sugar, watch for corn syrup, fructose, sucrose, or maltose in the ingredient list.

Meatespecially red meatis high in saturated fats, which cause high cholesterol and inflammation. On top of this, meat also contains high levels of advanced glycation end products (AGEs) that stimulate inflammation, particularly when meat is cooked by broiling, grilling, roasting, or frying it.1

Its not just fried chicken you should avoid, though. Other fried foods, such as donuts and French fries, contain trans fats in addition to AGEs.

See An Anti-Inflammatory Diet for Arthritis

This includes white bread, white pasta, and crackers. Refined grains (as opposed to whole grain products) cause a spike in blood glucose level, which has been shown to increase levels of several inflammation-markers in the body.

Another factor to consider about grains: People with gluten sensitivities may experience joint pain and inflammation from consuming wheat products.

See How Gluten Can Cause Joint Pain

Cheese, butter, cream cheese, margarine, and mayonnaise are all high is both saturated fats and AGEstheyre big inflammation triggers and should be consumed sparingly.

Corn, peanut, sunflower, safflower, and soy oils are high in omega-6 fatty acids, which are healthy in small doses. But excessive omega-6 consumption can trigger inflammatory chemicals.

This is not the case for the types of oils rich in omega-3 fatty acids, such as olive, canola, and flaxseed oils. These varieties are healthy, even in larger amounts.

See The Ins and Outs of an Anti-Inflammatory Diet

Avoiding foods and drinks that trigger inflammation is not just good for your arthritis. An anti-inflammatory diet can also help prevent other chronic conditions like heart disease and diabetes.

See Ingredients That May Trigger Fibromyalgia Symptoms

Before you despair that everything tasty seems to be off-limits if you want to practice an anti-inflammatory diet, keep in mind that a few simple swaps can often make the difference between healthy and unhealthy food choices. For example, cook with canola oil instead of corn oil, or swap out white bread for whole grain bread.

Managing RA Fatigue Through Diet and Exercise

Gout Prevention Diet

Read the original post:
In the Kitchen with Arthritis: Foods to Avoid

Read More...

Knee Arthritis Diagnosis and Treatment – verywellhealth.com

Sunday, January 6th, 2019

Arthritis of the knee joint is one of the most common causes of knee pain. There are different types of arthritis that can affect the knee joint, and the treatments may vary depending on the specific condition that is causing the symptoms.

Osteoarthritis is the most common type of knee arthritis. Also called wear-and-tear arthritis or degenerative joint disease, osteoarthritis is characterized by progressive wearing away of the cartilage in the joint. As the protective cartilage is worn away, bone is exposed, the knee becomes swollen, and activities become increasingly painful.

Knee arthritis symptoms tend to gradually progress as the condition worsens, however, symptoms may suddenly worsen with minor injury or overuse. Some patients report long episodes of mild symptoms, with sudden changes that increase the severity of their symptoms. Often patients report good months and bad months, or symptoms that fluctuate with the weather. This is important to understand because comparing the symptoms of arthritis on one particular day may not accurately represent the overall progression of the condition. Since there is not a cure for arthritis, learning ways to slow the progression of arthritis is also important.

Treatment should begin with the most basic steps and progress to the more invasive, possibly including surgery. Not all treatments are appropriate for every patient, and you should have a discussion with your doctor to determine which treatments are appropriate for your particular situation. The range of options includes:

See the rest here:
Knee Arthritis Diagnosis and Treatment - verywellhealth.com

Read More...

TYLENOL 8-HR Arthritis Pain | TYLENOL

Sunday, January 6th, 2019

TYLENOL 8-HR Arthritis Pain | TYLENOLSkip to main content

Works fast and lasts all day, up to 8 hours.Available as caplets.

Enroll in a program to help you on your journey and get personalized support.

Get the facts about joint pain and osteoarthritis.

This website contains current product information and may differ from the information on the product packaging you may have.

Enroll in a program to help you on your journey and get personalized support.

Get the facts about joint pain and osteoarthritis.

Review Questions:

Tylenol is the brand I prefer for fast, effective pain relief.:Yes

Review Text:

Fast relief recommended by dr. Best thing ever for me would recommend it to anyone and everyone who has arthritis

Recommended:

Yes, I'd recommend this product

Overall:

12345

Helpfulness:

Was this review helpful to you?

Review Questions:

Tylenol is the brand I prefer for fast, effective pain relief.:Yes

Review Text:

Life saver! I find that when I take one Tylenol Arthritis with one Aleve, I have a good 7/8 hours Pain Free From My Rgeumatoid Arthritis. I asked my doctor if it was safe for me to take and he said YES!! When I have a bad flare, I might need stronger medication but this works very well! Im trying to just take this along with herbal supplements for my arthritis

Recommended:

Yes, I'd recommend this product

Overall:

12345

Helpfulness:

Was this review helpful to you?

Review Questions:

Tylenol is the brand I prefer for fast, effective pain relief.:Yes

Review Text:

Tylenol 8hr. Arthritis formula was more effective at controlling my pain than most of the medications the doctor prescribed for me after I hurt my lower back and had sciatica in my left leg for about a year.

Recommended:

Yes, I'd recommend this product

Overall:

12345

Helpfulness:

Was this review helpful to you?

Review Questions:

Tylenol is the brand I prefer for fast, effective pain relief.:No

Review Text:

I think Tylenol is good for some headaches, but it doesnt seem to touch the pain when its muscular or for joints. I have arthritis in my hands and lower back. It really was almost like I had taken nothing. I kept taking it, hoping that it needed to build up in my system or something. Ibrupophen seems to work better for those kind of pains. I cant take those anymore due to stomach issues. Is Tylenol even for inflammation? What makes this good for arthritis? The high dosage amount? I had high hopes. That was just a waste of money.

Recommended:

Yes, I'd recommend this product

Overall:

12345

Client Responses:

Thanks for your feedback! We're so sorry to hear you haven't been feeling relief, and we want to learn more. Give us a call at 1-877-895-3665, we're here from 9AM to 5:30PM ET Monday through Friday. Hope to hear from you soon!

Helpfulness:

Was this review helpful to you?

Review Questions:

Tylenol is the brand I prefer for fast, effective pain relief.:No

Review Text:

I took two for Arthritis pain it never helped. The only reason I'm taking Tylenol is because my doctor said it was better for me than another brand I was taking that did work for me.

Recommended:

No, I would not recommend this product

Overall:

12345

Client Responses:

Hi there, thanks for leaving your review! We're sorry to hear you didn't find relief with this product, so we'd like to learn more and help make it up to you. Please give us a call at 1-877-895-3665 from 9AM - 5:30PM ET, Monday through Friday. Hope to hear from you soon!

Helpfulness:

Was this review helpful to you?

Review Text:

yeah! thanks for sharing this information. here I want to share About homeopathy treatment for Arthritis. Arthritis is a term often used to mean any disorder that affects joints. A joint is an area, where two different bones meet. I suggest livehomeo is the best clinics information for Arthritis treatment. visit for more details : https://www.livehomeo.com/treatments/fight-arthritis-fatigue/

Recommended:

Yes, I'd recommend this product

Location:

Hyderabad, Telangana, India

Overall:

12345

Review Questions:

Tylenol is the brand I prefer for fast, effective pain relief.:No

Review Text:

This product works well on pain but the side effects are too severe on the stomach.

Recommended:

No, I would not recommend this product

Overall:

12345

Client Responses:

We're sorry to hear this and we'd like to learn more! Please give us a call at 1-877-895-3665 from 9AM - 5:30PM ET, Monday through Friday. Thank you!

Helpfulness:

Was this review helpful to you?

Review Questions:

Tylenol is the brand I prefer for fast, effective pain relief.:Yes

Review Text:

Does this work for night time pain? Is there a Tylenol pm for arthritis?

Overall:

12345

Helpfulness:

Was this review helpful to you?

Log in using your account with

By registering, you agree to receive additional communications regarding product information, promotions, newsletters and surveys from our site. If you choose to register with a social provider, certain information will be shared by your social provider with our site.

{* traditionalSignIn_signInButton *}

Welcome back, {* welcomeName *}!

Welcome back!

{* traditionalSignIn_signInButton *}

All Fields required, unless otherwise indicated

Will be used as your user name

By submitting your information above, you agree that the information you provide will be governed by our site's Privacy Policy.

By submitting your information you agree to our sites Privacy Policy.

All fields required unless otherwise indicated

See more here:
TYLENOL 8-HR Arthritis Pain | TYLENOL

Read More...

Genetic Counseling – Bronx – Westchester – New York …

Saturday, January 5th, 2019

At Montefiore, our approach to genetic testing and research demonstrates a unique recognition of the increasing importance of this field. We are one of the only institutions worldwide to have placed our Division of Reproductive Genetics within our Obstetrics & Gynecology Department, rather than within pediatrics, which allows our patients to receive highly specialized care before and during all stages of their pregnancies.

With our ever-growing knowledge of genetics, our approach to prenatal care and overall healthcare for women incorporates a new range of interventions and treatments. We are expanding the field further with ongoing research and patient care, and by training the next generation of experts through Montefiore's affiliation with the Albert Einstein College of Medicine.

Our doctors are among only a few nationally who have a specialty in medical genetics coupled with a foundation in gynecology. Women can expect comprehensive care that addresses all aspects of their own health and prenatal needs.

When a pregnant woman receives an ultrasound at Montefiore, we apply our expertise in genetics to look for Down Syndrome and other syndromes and birth defects, whether related to chromosomes or single genes. We continually expand our expertise by performing more than 1,500 amniocenteses annually. Our doctors have published many papers on topics related to unusual ultrasounds.

Montefiore's range of experts and well-coordinated services offer patients complete care without the stress of traveling between multiple sites. Such centralized treatment is especially important because of the emotional and physical stress of dealing with a serious problem. After managing women's care for more than 30 years, we have ample experience synchronizing treatments between departments such as Gynecology, Obstetrics, Pathology and Psychiatry.

We are also expanding our work on the link between genetics and infertility, including male infertility. Those seeking infertility treatments, such as in vitro fertilization, can talk to our expert geneticists about the latest advancements in the field in genetic counseling.

And because we work closely with our colleagues in pediatrics, our patients can be confident that they will receive informed, caring treatment through every stage of pregnancy and childbirth.

We are also committed to expanding our expertise in the field of cancer genetics specific to women, including testing for:

As we gain a greater understanding of the genes that predispose people to specific cancers, we are able to save lives by using a complete family history and genetic testing to identify patients who may be at risk.

Women can now receive therapies to treat and prevent cancer earlier than ever before. Montefiore's leadership in the field is evident in the increasing number of patients who are referred to us by doctors at other medical centers in the region because of our state-of-the-art care.

Please print and fill out the Genetics Questionnaire before your appointment with the geneticist or genetic counselor because it will be helpful for us. If you have medical records or family records, please bring them with you to your appointment.

Go here to read the rest:
Genetic Counseling - Bronx - Westchester - New York ...

Read More...

The 5 Worst Foods To For Arthritis

Friday, January 4th, 2019

This video player is not support on your device, please click HERE to try a different player. We apologize for this inconvenience.

*Results will vary based on how long and how closely you follow the information presented, as well as other individual biological factors.

How long would YOU like to be pain free?

Look, I know you're skeptical. You should be. Look at all the big drug companies who are lying to you each and every day trying to convince you that their dangerous (sometimes deadly!) drugs are safe.

So I thought there's no better way for you to find out if Heal-n-Soothe will work for you, than having you try it. And that's why I'd like to send you a 90 count bottle, a 30 day supply, for free. You just pay the shipping and handling.

No matter what your arthritis pain level and frequency, fill out the risk-free acceptance form below to see how well Heal-n-Soothe will work for you.

STEP 1: Where Should We Ship Your FREE Bottle?

Country *

Choose your country AFGHANISTANALBANIAALGERIAAMERICAN SAMOAANDORRAANGOLAANGUILLAANTARCTICAANTIGUA AND BARBUDAARGENTINAARMENIAARUBAAUSTRALIAAUSTRIAAZERBAIJANBAHAMASBAHRAINBANGLADESHBARBADOSBELARUSBELGIUMBELIZEBENINBERMUDABHUTANBOLIVIABOSNIA AND HERZEGOVINABOTSWANABOUVET ISLANDBRAZILBRITISH INDIAN OCEAN TERRITORYBRUNEI DARUSSALAMBULGARIABURKINA FASOBURUNDICAMBODIACAMEROONCANADACAPE VERDECAYMAN ISLANDSCENTRAL AFRICAN REPUBLICCHADCHILECHINACHRISTMAS ISLANDCOCOS (KEELING) ISLANDSCOLOMBIACOMOROSCONGOCONGO, THE DEMOCRATIC REPUBLIC OF THECOOK ISLANDSCOSTA RICACOTE D'IVOIRECROATIACUBACYPRUSCZECH REPUBLICDENMARKDJIBOUTIDOMINICADOMINICAN REPUBLICECUADOREGYPTEL SALVADOREQUATORIAL GUINEAERITREAESTONIAETHIOPIAFALKLAND ISLANDS (MALVINAS)FAROE ISLANDSFIJIFINLANDFRANCEFRENCH GUIANAFRENCH POLYNESIAFRENCH SOUTHERN TERRITORIESGABONGAMBIAGEORGIAGERMANYGHANAGIBRALTARGREECEGREENLANDGRENADAGUADELOUPEGUAMGUATEMALAGUINEAGUINEA-BISSAUGUYANAHAITIHEARD ISLAND AND MCDONALD ISLANDSHOLY SEE (VATICAN CITY STATE)HONDURASHONG KONGHUNGARYICELANDINDIAINDONESIAIRAN, ISLAMIC REPUBLIC OFIRAQIRELANDISRAELITALYJAMAICAJAPANJORDANKAZAKHSTANKENYAKIRIBATIKOREA, DEMOCRATIC PEOPLE'S REPUBLIC OFKOREA, REPUBLIC OFKUWAITKYRGYZSTANLAO PEOPLE'S DEMOCRATIC REPUBLICLATVIALEBANONLESOTHOLIBERIALIBYAN ARAB JAMAHIRIYALIECHTENSTEINLITHUANIALUXEMBOURGMACAOMACEDONIA, THE FORMER YUGOSLAV REPUBLIC OFMADAGASCARMALAWIMALAYSIAMALDIVESMALIMALTAMARSHALL ISLANDSMARTINIQUEMAURITANIAMAURITIUSMAYOTTEMEXICOMICRONESIA, FEDERATED STATES OFMOLDOVA, REPUBLIC OFMONACOMONGOLIAMONTSERRATMOROCCOMOZAMBIQUEMYANMARNAMIBIANAURUNEPALNETHERLANDSNETHERLANDS ANTILLESNEW CALEDONIANEW ZEALANDNICARAGUANIGERNIGERIANIUENORFOLK ISLANDNORTHERN MARIANA ISLANDSNORWAYOMANPAKISTANPALAUPALESTINIAN TERRITORY, OCCUPIEDPANAMAPAPUA NEW GUINEAPARAGUAYPERUPHILIPPINESPITCAIRNPOLANDPORTUGALPUERTO RICOQATARREUNIONROMANIARUSSIAN FEDERATIONRWANDASAINT HELENASAINT KITTS AND NEVISSAINT LUCIASAINT PIERRE AND MIQUELONSAINT VINCENT AND THE GRENADINESSAMOASAN MARINOSAO TOME AND PRINCIPESAUDI ARABIASENEGALSERBIA AND MONTENEGROSEYCHELLESSIERRA LEONESINGAPORESLOVAKIASLOVENIASOLOMON ISLANDSSOMALIASOUTH AFRICASOUTH GEORGIA AND THE SOUTH SANDWICH ISLANDSSPAINSRI LANKASUDANSURINAMESVALBARD AND JAN MAYENSWAZILANDSWEDENSWITZERLANDSYRIAN ARAB REPUBLICTAIWAN, PROVINCE OF CHINATAJIKISTANTANZANIA, UNITED REPUBLIC OFTHAILANDTIMOR-LESTETOGOTOKELAUTONGATRINIDAD AND TOBAGOTUNISIATURKEYTURKMENISTANTURKS AND CAICOS ISLANDSTUVALUUGANDAUKRAINEUNITED ARAB EMIRATESUNITED KINGDOMUNITED STATESUNITED STATES MINOR OUTLYING ISLANDSURUGUAYUZBEKISTANVANUATUVENEZUELAVIET NAMVIRGIN ISLANDS, BRITISHVIRGIN ISLANDS, U.S.WALLIS AND FUTUNAWESTERN SAHARAYEMENZAMBIAZIMBABWE

State *

Choose your state AlabamaAlaskaArizonaArkansasCaliforniaColoradoConnecticutDelawareFloridaGeorgiaHawaiiIdahoIllinoisIndianaIowaKansasKentuckyLouisianaMaineMarylandMassachusettsMichiganMinnesotaMississippiMissouriMontanaNebraskaNevadaNew HampshireNew JerseyNew MexicoNew YorkNorth CarolinaNorth DakotaOhioOklahomaOregonPennsylvaniaRhode IslandSouth CarolinaSouth DakotaTennesseeTexasUSAF, AmericasUSAF, EuropeUSAF, PacificUtahVermontVirginiaWashingtonWashington DCWest VirginiaWisconsinWyoming

Get Your FREE Bottle

Learn about the trouble making vegetable, YES VEGETABLE that can make your Arthritis worse. (And Make you feel 5 - 10 years older.)

The secret switch inside your body that you can flip to help make it start acting like it did when you were 25 years old.

The real reason why pain killers don't help your pain.

Which special superfood can actually counteract the damage or arthritis.

Adler A, Holub B. Effect of garlic and fish-oil supplementation on serum lipid and lipoprotein concentrations in hypercholesterolemic men. American Journal of Clinical Nutrition. 1997 Feb;65(2):445-50.

NIAMS, NIH, Bethesda, Maryland 20892, USA. Arthritis & Rheumatology (Impact Factor: 7.87).06/1998; 41(5):778-99. DOI: 10.1002/1529-0131(199805)41:5<778::AID-ART4>3.0.CO;2-V Source: PubMed

Hrlimann, David, Frank Enseleit, and Priv-Doz Dr Frank Ruschitzka. Rheumatoide arthritis, inflammation und atherosklerose. Herz 29.8 (2004): 760-768.

Schett, Georg. Rheumatoid arthritis: inflammation and bone loss. Wiener Medizinische Wochenschrift 156.1-2 (2006): 34-41.

See the article here:
The 5 Worst Foods To For Arthritis

Read More...

Integrative medicine – Mayo Clinic

Wednesday, January 2nd, 2019

Overview

Complementary and alternative medicine (CAM) is the popular name for health care practices that traditionally have not been part of conventional medicine. In many cases, as evidence of efficacy and safety grows, these therapies are being combined with conventional medicine.

Thus, the term alternative has been dropped and replaced with newer terms, such as complementary and integrative medicine, integrative medicine and health, or just integrative medicine.

Integrative medicine can help people with cancer, persistent pain, chronic fatigue, fibromyalgia and many other conditions better manage their symptoms and improve their quality of life by reducing fatigue, pain and anxiety. Examples of common practices include:

The treatments promoted in integrative medicine are not substitutes for conventional medical care. They should be used in concert with standard medical treatment.

Certain therapies and products are not recommended at all or not recommended for certain conditions or people. The National Center for Complementary and Integrative Health is a good tool for researching a therapy you're considering. It's also important to talk with your health care provider before trying something new.

Explore Mayo Clinic studies testing new treatments, interventions and tests as a means to prevent, detect, treat or manage this disease.

Integrative medicine care at Mayo Clinic

June 29, 2018

Read more from the original source:
Integrative medicine - Mayo Clinic

Read More...

Integrative Medicine | Parkview Health | NE Indiana and NW …

Wednesday, January 2nd, 2019

Integrative medicine and functional medicine focus on allowing the body to heal and regulate itself by living nutritionally and physically well. Your provider will work with you to determine your health needs based on a whole-body approach. Integrative medicine is healing-oriented and emphasizes the relationship between provider and patient, ensuring a full understanding of your inner well-being.

Our practices are based on a scientific understanding of how the body reacts to circumstances within itself. We are all built uniquely and with a true understanding of what wellness and health means to us as an individual, our bodies are capable of self-rejuvenating and healing so that we can feel alive and well again.

These are a few of the services that may be offered to you as an integrative medicine patient.

Hormones affect all aspects of our lives including our energy, sense of well-being and our immune system. We offer evaluation and treatment with bio-identical options for both women and men. We monitor levels on treatment and work with individuals to achieve balance and relief of symptoms associated with perimenopause, menopause and andropause.

Inflammation is the silent fire that causes health issues like heart disease, diabetes, obesity, hypertension and cancers by turning on and off the genes that cause or prevent disease. We offer evaluation of inflammatory markers and suggest lifestyle changes, nutrition, supplements and medications to help stop inflammation in its path.

Nutrition isnt just about maintaining a healthy weight; its about preventing disease. We can look at your individual bio-chemistry to help design a program that takes into account your genetics and food sensitivities. Let us help you find the right fuel for your body.

Read more here:
Integrative Medicine | Parkview Health | NE Indiana and NW ...

Read More...

Avoid This Unnecessary Surgery – LewRockwell

Tuesday, January 1st, 2019

By Dr. Mercola

Arthroscopic knee surgery is one of the most common unnecessary surgeries performed todayalong with back and hip surgeries, pacemakers, cardiac angioplasties, hysterectomies, and Cesarean sections.

Several studies over the past decade have highlighted questions about arthroscopic knee surgery, and now, you can add one more to the pile. The meniscus inside your knee is a thin crescent-shaped disc of cartilage that serves as a cushion between your femur and tibia and helps stabilize your knees.

Over time, your meniscus can develop tears, especially if you have arthritis. The standard orthopedic surgeons intervention for meniscal tears is performing an arthroscopic partial meniscectomytrimming the torn meniscus and smoothing the jagged edges of what remains, which assumes the tear is whats causing your pain. However, that may be a faulty assumption.

This is a Flash-based video and may not be viewable on mobile devices.

Visit the Mercola Video Library

Knee Surgery No Better Than ShamBioAstin Hawaiian Asta...Buy New $23.97(as of 02:10 EST - Details)

This latest study, conducted in Finland, examined 146 patients with degenerative meniscal tears (caused by wear and tear, not acute injury).1Researchers divided patients into two groups.

One group received the standard surgery, and the other received a sham surgeryin other words, a fake or placebo intervention where no actual surgery takes place. The study excluded people with knee arthritis, because they tend not to benefit as much from meniscus surgery and the researchers wanted to ascertain if the surgery helps under ideal circumstances.2

The sham surgery involved the physicians making an incision and poking around without any actual cartilage shaving or cutting. Many of the patients were given epidural anesthesia, so they were awake, making it necessary for surgical staff to use their theatrical talents to pull off a believable sham surgery.

The outcome? One year later, both groups reported equally favorable responses to the procedureprimarily, reduction in knee pain. In the end, the researchers concluded that the real knee surgeries offered no better outcomes than the sham surgeries.

Arthroscopic surgery on the meniscus is the most common orthopedic procedure in the US, and according to this study, is performed about 700,000 times a year to the tune of $4 billion. Any surgeon who tells you this is the best or only option for your osteoarthritic knee pain will not have a leg to stand on when you show him or her all of the evidence to the contrary.

Arthroscopic Surgeries Have an Embarrassing Track Record

Prior to the Finnish study, there were already three prior studies of note that should have orthopedic surgeons rethinking how they treat their knee patients:

See the pattern emerging here? Its hard to miss! Eighty percent of meniscal tears develop from wear and tear over time.6If you have pain in your knees from ordinary activities or arthritis, you may be better off skipping the surgery and going straight to physical therapy.

Or better yet, get some treatments with an infrared laser that I discussed in detail withDr. Harrington.

Of course, there are other non-invasive therapies that can be helpful as well. But its becoming quite clear that a torn meniscusat least, the wear-and-tear varietyis not going to be helped by a surgical trim. Surgeries come with all sorts of risks, and there is no point in exposing yourself to these without some clear advantage.

If you have a torn meniscus from an accident or injury, the scenario may be different, but I would still recommend you getting a second or even third opinion before going under the knife.

The Power of Placebo

With TWO studies now highlighting the benefits of placebo knee surgeries, the power ofplacebojust cant be ignored. Placebos typically have far fewer side effects (if any) than prescription drugs, injections, or actual surgeriesand they often work just as well as the standard of care.Studies have shown that if youthinkyoure receiving a treatment, and you expect that treatment to work, it often doeseven if you know youre receiving aplacebo.

This was beautifully demonstrated in the Finnish studythe knee surgery patients knew they might be having a sham surgery, yet they experienced the benefits anyway. But how do placebos work? How can your brain produce healing just because youbelieveit should be happening?Although the exact mechanisms of the placebo effect are not well understood, it seems related to changes in your brain in response to different psychosocial stimuli. Areas of your brain associated with expectations, anxiety, and rewards seem to be involved.Scientific Americanreported:7

In recent decades reports have confirmed the efficacy of various sham treatments in nearly all areas of medicine. Placebos have helped alleviate pain, depression, anxiety, Parkinsons disease, inflammatory disorders and even cancer.

Placebo effects can arise not only from a conscious belief in a drug but also from subconscious associations between recovery and the experience of being treatedfrom the pinch of a shot to a doctors white coat.Such subliminal conditioning can control bodily processes of which we are unaware, such as immune responses and the release of hormones Researchers have decoded some of the biology of placebo responses, demonstrating that they stem from active processes in the brain.

You can tap into your own placebo effect with techniques such asEFT or Emotional Freedom Technique.This is a new way of thinking about healing for most people that can be extremely powerful, especially when combined with a positive outlook and a proactive,disease-preventive lifestyle.

Your Secret Weapon Against Knee Pain: Exercise

Exercise is the real medicine for pain in your joints.Exercisehelps prevent and relieve joint pain through a number of mechanisms, including strengthening key supportive muscles, improving flexibility and range of motion, improving bone strength, and helping you optimize your weight. The notion that exercise is detrimental to your joints is a serious misconception; there is no evidence to support this belief. Its simply a myth that you can wear down your knees just from average levels of exercise and/or normal activity.

This is not to say that traditional pavement-pounding, likedistance running, is going to be of any benefit to your kneesIm talking about low-impact but effective exercise, such ashigh-intensity interval training (HIIT),high-intensity cardio,weight training,stretching, and core work. If you find youre in pain for more than an hour after your workout, you should slow down or choose another form of exercisethere really are plenty to choose from.

If youve already developed osteoarthritis in your knees, youll want to incorporate exercises that strengthen your quadriceps muscle at the front of your thigh. And, rather than running and other high-impact activities, you may be better off with non-weight-bearing exercises like swimming and cycling. Strengthening and stretching the areas around, above, and below your knee is key to reducing most knee pain, which is the goal of the exercises I demonstrate in the video above. I recommend a qualified physiotherapist to properly assist you with your exercises to avoid injury. Make sure to wear appropriate footwear for all of your daily activities. Spiked heels and very flat soled shoes place unnatural stresses on your knees. Goodpostureis important as well.

For joint pain, many physicians commonly recommend anti-inflammatory drugs (non-steroidal anti-inflammatories or NSAIDs) and analgesics (such as Tylenol) to their osteoarthritis patients. I dont recommend the chronic use of these drugs due to significant side effects, which may include kidney and/or liver damage. There are safer and more effective natural options for relieving joint pain. Although popular, I am also not much of aglucosamine and chondroitinfan because studies have failed to demonstrate their effectiveness. However, there are some very effective natural remedies that are truly backed up by science. The following are my favorites:

Sun exposure is your best option, because your skin produces two types of sulfur in response to sun exposure: cholesterol sulfate and vitamin D3 sulfate. Sulfur plays a vital role in the structure and biological activity of both proteins and enzymes. If you dont have sufficient sulfur in your body, this deficiency can create a number of health problems, including negative impacts on your joints and connective tissue. Which brings us to the next item

Methylsulfonylmethane (known asMSM) is another alternative you might find helpful. MSM is an organic form of sulfur and a potent antioxidant naturally found in many plants, and is available in supplement form. For more on the benefits of MSM, I recommend listening to this interview.

Eggshell membrane also contains transforming growth factor-B, a protein that helps with tissue rejuvenation, in addition to other amino acids and structural components that provide your joints with the building blocks they need to build cartilage.

Sources and References

The Best of Joseph Mercola

See more here:
Avoid This Unnecessary Surgery - LewRockwell

Read More...

Longevity | Smallville Wiki | FANDOM powered by Wikia

Tuesday, January 1st, 2019

Longevity is the ability to live or persist for extended periods of time.

Unlike some of their other abilities like superhuman strength, speed, stamina, and invulnerability, this ability appears to manifest for Kryptonians a while later after they get introduced to an environment under a yellow sun, and as such, this ability seems to require a certain amount of storage of rays given off by a yellow sun for it to take effect [citationneeded]

The Kryptonian machine computer program called Brainiac appeared to operate indefinitely. [citationneeded]Davis Bloome can live for very long periods of time. [citationneeded]

Among Kryptonians, blue kryptonite can hinder this ability. Dax-Ur aged while wearing a blue kryptonite rock on his wrist.

Darkseid was present on Earth during its darkest points in history but was banished away by Orion's bow.

Curtis Knox is an immortal, the source of his immortality was never discovered, he was around centuries before the first meteor showers occurred.

Clark Kent was initially afraid of this ability while he was an adolescent, fearing the that he would eventually outlive everyone including the ones he loves. After his friend Ryan dies, he learns that time is valuable, and that he shouldn't take someone's life for granted, as it will end sometime. When the Crystal of Air gets stained with human blood, a second meteor shower is triggered, and the Black Ship ventures to Earth, bringing Aethyr and Nam-Ek to Earth. Here, they attempt to get Kal-El to join them in making Earth a utopia and a new Krypton in which they would rule forever but Clark denies them and traps them in the Phantom Zone. After Clark becomes mortal when Jor-El removes his abilities, he gets shot and dies at 7:18 AM. Jor-El inhabits Lionel's body and revives Clark, restoring his powers, so he can complete his Kryptonian destiny because "his mortal journey has ended".

Later on, his cousin Kara reminds him that trying to love Lana and live with her till she grows old is a foolish idea because he will out live her. Clark later accepts this ability, as shown while he was talking with John Jones, admitting that eventually "they'll all be gone".

Please add quotes about longevity and immortality here.

Originally posted here:
Longevity | Smallville Wiki | FANDOM powered by Wikia

Read More...

Longevity – Wellness – Sharecare

Tuesday, January 1st, 2019

Maintaining your muscle mass through the ages has an aesthetic appeal. You will automatically look better because you will be toned and shapely with less sagging-and-floppy arms, and less fat.

Ideally, a well-rounded and comprehensive exercise program includes cardio work, strength training, and stretching. Each of these activities affords you unique benefits that your body needs to achieve and maintain peak performance. Cardio work, which gets your heart rate up for an extended period of time, will burn calories, lower body fat, and strengthen both your heart and lungs; strength training (use of weights or elastic bands, or even your own body weight as resistance in some cases) will keep your bones strong and prevent the loss of lean muscle mass that naturally occurs with age; and stretching will keep you flexible and less susceptible to joint pain. All three of these forms of exercise will keep your body moving and also help you to maintain good posture, which will instantly make you look younger. The type of activity you do is not nearly as important as how often you do it, and how long you do it. Because exercise lowers stress for up to twenty-four hours, its important to avoid being a weekend warrior and make it a goal of keeping a semi-daily routine.

Dont forget that the benefits of exercise are cumulative. Another fact science has proven is that you dont have to sweat it out on a treadmill for a full sixty minutes. You can do ten minutes here, twenty minutes there. (Like calories, it all adds up!) Sprinkle pockets of workout times into your day -- at lunch, after dinner, or in the fifteen minutes right after you get up and the house is still quiet.

No matter which form or type of exercise you choose to do, its positive impact on your skin and overall looks cannot be underestimated. I don't know anybody who is fit and who looks older than she should, do you?

From The Mind-Beauty Connection: 9 Days to Less Stress, Gorgeous Skin, and a Whole New You by Amy Wechsler.

Read more:
Longevity - Wellness - Sharecare

Read More...

Page 41234


2025 © StemCell Therapy is proudly powered by WordPress
Entries (RSS) Comments (RSS) | Violinesth by Patrick